| Instruction and Safety Manual   for Gasoline Power Cuts   DPC7311HD   DPC7321HD   WARNING!   Read and understand this Manual. Always follow safety precautions in the Instruction and   Safety Manual. Improper use can cause serious injury!   The engine exhaust from this product contains chemicals known to the State of California to cause   cancer, birth defects or other reproductive harm. Preserve this Manual carefully!   Download from Www.Somanuals.com. All Manuals Search And Download.   Thank you for purchasing a MAKITA product!   Table of contents   Page   Congratulations on choosing a MAKITA Power Cut cutoff saw!   We are confident that you will be satisfied with this modern   piece of equipment. Like our chain saws, the MAKITA Power   Cuts feature specially designed high-performance engines   with outstanding power-to-weight ratios, for heavy-duty yet   lightweight tools.   Packing ................................................................................ꢂ   Delivery inventory ..............................................................4   Symbols ...............................................................................4   SAFETY PRECAUTIONS   Intended use ...................................................................5   General precautions .......................................................5   Protective equipment ...................................................5-6   Fuels / Refuelling ............................................................6   Putting into operation ......................................................6   Cutting discs ...................................................................7   Kickback and lock-in .......................................................8   Working behavior / Method of working ............................8   Cutting metal ...................................................................9   Cutting masonry and concrete ...................................9-ꢀ0   Transport and storage ...................................................ꢀ0   Maintenance ................................................................. ꢀꢀ   First aid ......................................................................... ꢀꢀ   Technical data ...................................................................ꢀꢁ   Denomination of components .........................................ꢀꢁ   Other advantages of the MAKITA Power Cuts:   • Sturdy construction and high reliability.   • Maintenance-free electronic ignition, hermetically sealed to   protect against dust and moisture.   • VibrationdampingwiththeMAKITAꢁ-masssystem(DꢁM)for   tireless working even when guiding the Power Cut by hand.   • Five-stage air-filter system for reliable working even under   very dusty conditions.   • Two options for mounting the cutter attachment: Either cen-   trally, for good balance when guiding the unit manually, or on   the side, for flush cuts along walls or curbsides or horizontally   directly above the ground.   • Extensive range of resin-bonded and diamond grit cutting   discs, trolley with dust catcher, and systems for supplying   water to the disc.   PUTTING INTO OPERATION   Mounting the cutting disc...............................................ꢀꢂ   Tightening the V-belt / Checking V-belt tension ............ꢀ4   Fuels / Refuelling .....................................................ꢀ4-ꢀ5   Starting the engine ........................................................ꢀ6   Cold-starting .................................................................ꢀ6   Warm-starting ...............................................................ꢀ7   Stop engine ...................................................................ꢀ7   The following industrial property rights apply:   US 08510690, SE 95027298, SE 95027306, IT 95000653,   IT 95000654, GBM 9412558, GBM 9412559.   We want you to be satisfied with your MAKITA product.   In order to guarantee the optimal function and performance of   your Power Cut and to ensure your personal safety we would   request you to perform the following:   Adjusting the carburetor ..................................................ꢀ8   MAINTENANCE   Read this Instruction and Safety Manual carefully before   putting the Power Cut into operation for the first time,   andstrictlyobservethesafetyregulations!Failuretoobser-   ve these precautions can lead to severe injury or death!   Changing the V-belt ......................................................ꢀ9   Cleaning the protection hood ........................................ꢁ0   Cleaning / changing the air filter ..............................ꢁ0-ꢁꢀ   Replacing the spark plug ..............................................ꢁꢀ   Replacing the suction head ..........................................ꢁꢁ   Replacing the starter cable ......................................ꢁꢁ-ꢁꢂ   Replacing the return spring ...........................................ꢁꢂ   Instructions for periodic maintenance ...........................ꢁ7   Cutting attachment in central / side position ............ꢁ4-ꢁ5   Repositioning the cutting attachment .......................ꢁ4-ꢁ5   Replacing/cleaning the spark arrester screen ..............ꢁ5   WARNING!   SPECIAL ACCESSORIES   Diamond cutting discs, trolley, water tank   Some dust created by power sanding sawing, grin-   ding, drilling, and other construction activities contains   chemicals known (to the State of California) to cause   cancer, birth defects or other reproductive harm.   and pressure water system .................................................ꢁ6   Service, spare parts and guarantee ...........................ꢁ7-ꢁ8   Troubleshooting ...............................................................ꢁ8   Extract from spare parts list ............................................ꢁ9   Accessories ..................................................................ꢁ9   Service stations .............................................................ꢂ0   Some examples of these chemicals are:   • • lead from lead-based paints,   crystalline silica from bricks and cement and   other masonry products, and   • arsenic and chromium from chemically-   treated lumber.   Your risk from these exposures varies, depending on   how often you do this type of work.   Packing   Your MAKITA Power Cut is packed in a cardboard box to pre-   vent shipping damage.   To reduce your exposure to these chemicals: work in   a well ventilated area, and work with approved safety   equipment, such as those dust masks that are specially   designed to filter out microscopic particles.   Cardboardisabasicrawmaterialandisconsequentlyreuseable   or suitable for recycling (waste paper recycling).   The Emissions Compliance Period referred to on the emission   Compliance label indicates the number of operating hours for   which the engine has been shown to meet federal emissions   requirements.   Category C= 50 hours, B= ꢀꢁ5 hours, and A= ꢂ00 hours.   ꢂ Download from Www.Somanuals.com. All Manuals Search And Download.   Delivery inventory   5 4 3 2 1 1. Power Cut   2. Cutting disc   3. Screwdriver (for carburetor adjustment)   4. Offset screwdriver   5. Universal wrench 13/19   In case one of the parts listed should not be included in the   delivery inventory, please consult your sales agent.   6. Instruction manual (not shown)   Symbols   You will notice the following symbols on the saw and in the Instruction Manual:   Read instruction manual and   follow the warning- and safety   precautions!   Never use carbide tipped, circular saw   blades or any kind of wood cutting   blades!   Particular care and caution!   Forbidden!   Combination Start/Stop (I/O) switch,   choke   Locked / Unlocked   Wear helmet and eye, respiratory   and hearing protection!   Press decompression valve   Wear protective gloves!   Engine - manual start   Working in winter   Stop engine!   Wear respiratory protection!   Hazardous dust and/or   gas emission!   Fire hazard from flying sparks!   Warning!   Kickback!   No smoking!   Fuel and oil mixture   First aid   No open fire!   Direction of cutting wheel rotation   Warning: the max. peripheral   speed of the cutting disc is 80 m/s!   Do not touch hot surfaces!   Cutting disc dimensions   4 Download from Www.Somanuals.com. All Manuals Search And Download.   SAFETY PRECAUTIONS   Intended use   Power Cut   wear protective goggles (C) or visor when using the Power   Cut.   UsethePowerCutcutoffsawoutdoorsonly,fortrimmingandcutting   suitable materials, using cutting discs rated for this machine.   - - - To prevent hearing damage, always wear suitable personal   hearing protection. (ear muffs (D), ear plugs, etc.). Octave   brand analysis upon request.   Improper use:   Never use the cutoff saw cutting discs for grinding or sanding (using   the side of the cutting disc to remove material). The disc can break!   Never use the Power Cut with saw blades, cutter blades, brushes,   carbide tipped, wood cutting blades etc.   When dry-cutting dust-producing materials such as stone   or concrete, always wear approved respiratory protection   (E).   Unauthorised users:   Work gloves (F) of tough leather are part of the required   work kit of the Power Cut and must always be worn when   working with the Power Cut.   Persons unfamiliar with the Instruction Manual, children, young   people, and persons under the influence of alcohol, drugs or medi-   cations must not use the Power Cut.   General precautions   - The operator MUST read this instruction manual to ensure   safe operation (even if you already have experience in us-   ing cutoff saws). It is important to be familiar with the opera-   tion of this particular cutoff saw. Users insufficiently informed   will endanger themselves as well as others due to improper   handling.   - Letonlypersonswhohaveexperienceinusingcutoffsawswork   with this unit. When letting another person use the Power Cut,   this instruction manual must be provided along with it.   ꢀ - - First-time operators should ask a specialist to instruct them in   working with gasoline-powered cutoff saws.   Childrenandpersonsunderꢀ8yearsofagemustnotbeallowed   to use this Power Cut. Persons over the age of ꢀ6 years may,   however, use the Power Cut for the purpose of being trained as   long as they are under the supervision of a qualified trainer.   - - Working with the Power Cut requires high concentration.   OperatethePowerCutonlyifyouareingoodphysicalcondition.   If you are tired, your attention will be reduced. Be especially   careful at the end of a working day. Perform all work calmly and   carefully. The user has to accept liability for others.   - - - Never work while under the influence of alcohol, drugs, medica-   tion or other substances which may impair vision, dexterity or   judgement.   ꢁ A fire extinguisher must be available in the immediate vicinity   when working in easily inflammable vegetation or when it has   not rained for a long time (danger of fire).   Asbestosandothermaterialsthatcanreleasetoxinsmaybecut   only with the necessary safety precautions and after notification   of the proper authorities and under their supervision or that of   a person appointed by them.   - The use of dust-reduction devices is urgently recommended   (see Accessories, pressure water tank, water tank).   Protective equipment   - In order to avoid head, eye, hand or foot injuries as well as   to protect your hearing the following protective equipment   must be used during operation of the Power Cut:   ꢂ - Thekindofclothingshouldbeappropriate, i. e. itshouldbetight-   fittingbutnotbeahindrance.Clothinginwhichgrainsofmaterial   can accumulate (trousers with cuffs, jackets and trousers with   wide-open pockets, etc.) must not be worn, particularly when   cutting metal.   - - Do not wear any jewellery or clothing that can get caught or   distract from the operation of the Power Cut.   It is necessary to wear a protective helmet whenever working   with the Power Cut. The protective helmet (A) is to be checked   in regular intervals for damage and is to be replaced after 5   years at the latest. Use only approved protective helmets.   E F - The helmet visor (B) protects the face from dust and material   grains. In order to prevent injuries to eyes and face, always   4 5 Download from Www.Somanuals.com. All Manuals Search And Download.   - - Alwayswearsafetyshoesorboots(G)withsteeltoes,non-skid   soles, and leg protectors when working with the Power Cut.   Safety shoes equipped with a protective layer provide protection   against cuts and ensure a secure footing.   Always wear a work suit (H) of tough material with sufficient   flame-retardant qualities whenever working with the cutoff   saw.   H G Fuels / Refuelling   - Go to a safe, level place before refuelling. Never refuel while   on scaffolding, on heaps of material, or in similar places!   - - - - Switch off the engine before refuelling the Power Cut.   Do not smoke or work near open fires (6).   5 6 7 Let the engine cool down before refuelling.   Fuels can contain substances similar to solvents. Eyes and skin   shouldnotcomeincontactwithmineraloilproducts.Alwayswear   protective gloves when refuelling (not the regular work gloves!).   Frequently clean and change protective clothes. Do not breathe   in fuel vapors. Inhalation of fuel vapours can be hazardous to   your health.   - Do not spill fuel. If a spill occurs, clean off the Power Cut im-   mediately. Fuel should not come in contact with clothes. If your   clothes have come in contact with fuel, change them at once.   - - Ensurethatnofueloozesintothesoil(environmentalprotection).   Use an appropriate base.   Refuelling is not allowed in closed rooms. Fuel vapors will ac-   cumulate near the floor (explosion hazard).   - Ensure to firmly tighten the screw cap of the fuel tank.   - Before starting the engine, move to a location at least ꢂ meters   (approx. ꢀ0 feet) from where you fuelled the Power Cut (7), but   not within the extended swing range of the cutting disc (direction   of sparks).   3 meters   (10 feet)   - - - - Fuel cannot be stored for an unlimited period of time. Buy only   as much as will be consumed in the near future.   When making up the gasoline/oil mixture, always put the oil in   the mixing container first, and then the gasoline.   Use only approved and marked containers for the transport and   storage of fuel.   Keep fuel away from children!   Putting into operation   - - - Do not work on your own. There must be someone around   in case of an emergency (within shouting distance).   Observe all anti-noise regulations when working in residential   areas.   30 m (100 feet)   Never use the Power Cut near inflammable materials or   explosive gases! The Power Cut can create sparks leading   to fire or explosion!   - - Make sure that all persons within ꢂ0 meters (ꢀ00 feet), such   as other workers, are wearing protective gear (see "Protective   Equipment") (8). Children and other unauthorized persons must   remain more than ꢂ0 meters away from the working area. Keep   an eye out for animals as well (9).   = wearing Protective Equipment   8 Before starting work the Power Cut must be checked for   perfect function and operating safety according to the pre-   scriptions. In particular, make sure that the cutting wheel is in   good condition(replace immediately if torn, damaged or bent),   the cutting wheel is properly mounted, the protective hood is   locked in place, the hand guard is properly mounted, the V-belt   has the proper tension, the throttle moves easily and the half-   throttle lock button functions properly, the grips are clean and   dry, and the combination switch functions properly (Start/Stop   (I/O) switch, choke). Visually inspect the muffler for damage and   possible dirt in the muffler area.   - Start the Power Cut only after complete assembly and inspec-   tion. Never use the Power Cut when it is not completely as-   sembled.   9 6 Download from Www.Somanuals.com. All Manuals Search And Download.   Cutoff discs   - The protection hood must always be on! Change discs only   with the engine off!   - There are two basic types of cutoff discs:   - For metal (hot cutting)   - For masonry (cold cutting)   WARNING!   Neverusecarbidetipped,circularsawbladesoranykindofwood   cutting blades. Never cut any type of wood. Reactive forces can   cause severe personal injury from blade contact or thrown tips.   NOTE:Whenusingdiamondcutoffdiscs,alwaysmakesuretoobserve   the "direction of rotation" markings. Diamond discs should only be   used for cutting masonry/brick/ concrete etc.   ꢀ0   ꢀꢀ   ꢀꢁ   - Cutoff discs are intended only for radial loading, i.e. for cutting. Do   not grind with the sides of the cutting disc! This will break the disc   (ꢀ0)!   Caution!   Never change direction (turning radius less than 5 meters /   16 feet), exert lateral (sideways) pressure, or tip the Power Cut   during cutting (ꢀꢀ)!   - - - Useacuttingdisconlyforcuttingthematerialsitisintendedfor.The   proper type of disc must be used, for either metals or masonry.   The arbor hole of the cutting disc must be an exact fit with the arbor   or shaft.   min. 5 m   (16 feet)   The cutting disc must be rated for freehand cutting at up to 4ꢂ70   rpm or 80 m/sec for ꢂ50 mm discs or up to 5ꢀ00 rpm or 80 m/s for   ꢂ00 mm discs. Use only cutting discs that comply with EN ꢀꢁ4ꢀꢂ,   EN ꢀꢂꢁꢂ6.   - The disc must be free of defects (ꢀꢁ). Do not use defective cutting   discs.   Always tighten the cutting disc mounting bolt to a torque of 30   Nm. Otherwise, the cutting disc can twist.   - Before starting the cutting disc, make sure you have a steady foot-   ing.   - Put the Power Cut into operation only as described in this instruc-   tion manual (ꢀꢂ).Always place your left foot in the rear handle and   grasptheotherhandlefirmly(withthumbandfingers).Otherstarting   methods are not allowed.   - - WhenstartingthePowerCutitmustbewellsupportedandsecurely   held. The cutting disc must not be touching anything.   If the cutting disc is new, test it by running it at least 60 seconds at   topspeed.Whendoingthis,makesurethatnopersonsorbodyparts   are in the extended swing range of the disc, in case it is defective   and flies apart.   - When working with the Power Cut always hold it with both   hands. Take the back handle with the right hand and the tubular   handle with the left hand. Hold the handles tightly with your thumbs   facing your fingers.   - CAUTION: When you release the throttle lever the disc will   keep spinning for a short period of time (free-wheeling effect).   Continuously ensure that you have a safe footing.   Hold the Power Cut such that you will not breathe in the   exhaustgas.Donotworkinclosedroomsorindeepholes   or ditches (danger of poisoning by fumes).   - - - - Switch off the Power Cut immediately if you observe any   changes in its operating behavior.   ꢀꢂ   Switch off the engine before inspecting the V-belt tension or   tighteningit,replacingthecuttingwheel,repositioningthecutter   attachment (side or middle position) or eliminating faults (14).   Turn off the engine immediately and check the disc if you hear or   feel any change in cutting behaviour.   - - ● Maintenance   ● Refuelling   Turn off the Power Cut when taking a break or stopping work (ꢀ4).   Place the unit in such a way that the disc is not touching anything   and cannot endanger anyone.   ● Changing cutoff discs   ● Repositioning the   cutting attachment   - Do not put the overheated Power Cut in dry grass or on any inflam-   mable objects. The muffler is very hot (danger of fire).   IMPORTANT:Afterwetcutting,firstturnoffthewaterfeedandthen   let the disc run at least 30 seconds, to fling off the remaining water   and prevent corrosion.   ● Stopping work   ● Transport   STOP   - ● Putting out of function   ꢀ4   7 Download from Www.Somanuals.com. All Manuals Search And Download.   Kickback and lock-in   - - - When working with the Power Cut there is a danger of kickback   and lock-in.   Kickback occurs when the top of the cutting disc is used for   cutting (ꢀ5).   This causes the Power Cut to be thrown back toward the user   with great force and out of control. Risk of injury!   To prevent kickback, observe the following:   - Never cut with the section of the cutting disc shown in figure 15.   Be especially careful when reinserting the disc into cuts   that have already been started!   ꢀ5   - - Lock-inoccurswhenthecutnarrows(crack,orworkpieceunder   stress).   This causes the Power Cut to suddenly jump forward, out of   control and with great force. Risk of injury!   To prevent lock-in, observe the following:   - - When reinserting the disc into previous cuts, have the Power   Cut running at top speed. Always cut at top speed.   Always support the workpiece so that the cut is under tension   (ꢀ6), so that the cut does not press together and jam the cutting   disc as it proceeds through the material.   - - When starting a cut, apply the disc to the workpiece with care.   Do not just shove it into the material.   Never cut more than one piece at a time! When cutting, make   sure that no other workpiece comes into contact.   Working behavior / Method of working   - Before starting work, check the work area for any hazards   (electrical wires, inflammable substances). Clearly mark the   work area (for example with warning signs or by cordoning off   the area).   ꢀ6   - - - When working with the Power Cut hold it firmly by the front and   rear handles. Never leave the Power Cut unattended!   Use the Power Cut at high speed as far as possible (see “Tech-   nical Data”).   Only use the Power Cut during good light and visibility periods.   Be aware of slippery or wet areas, and of ice and snow (risk of   slipping).   - Never work on unstable surfaces. Make sure that there are no   obstacles in the working area, risk of stumbling.Always ensure   that you have a safe footing.   - - - - Never cut above your shoulder height (ꢀ7).   Never stand on a ladder to cut (ꢀ7).   Never use the Power Cut while standing on scaffolding.   Do not lean over too far when working. When putting down and   picking up the Power Cut, do not bend over from the waist, but   instead bend in the knees. Save your back!   ꢀ7   - - - Guide the Power Cut in such a way that no part of your body   is within the extended swing range of the disc (ꢀ8).   Use cutting discs only for the materials for which they are de-   signed!   Use cutting discs only for the materials for which they are de-   signed. Do not use the Power Cut to lift up and shovel away   pieces of material and other objects.   Important! Before cutting, remove all foreign objects, such as   rocks, gravel, nails etc. from the cutting area. Otherwise, such   objects can be flung away by the disc with great speed. Injury   hazard!   - When cutting workpieces down to length use a firm support.   If necessary, secure the workpiece from slipping, but do not   steady it with your foot or allow another person to hold it.   - - When cutting round items, always secure them against rota-   tion.   When guiding the Power Cut by hand, use the side mounting   position of the cutter attachment only when actually necessary.   Otherwise, always use the central position. This gives the unit   a better balance, for reduced operator fatigue.   ꢀ8   8 Download from Www.Somanuals.com. All Manuals Search And Download.   When using synthetic resin cutting discs, always ob-   serve the following:   Cutting masonry and concrete   IMPORTANT!   Always wear approved respiratory protection!   CAUTION:   Asbestos and other materials that can release toxic sub-   stancesmaybecutonlyafternotifyingtheproperauthorities   and under their supervision or that of a person appointed   bythem.Whencuttingprestressedandreinforcedconcrete   piles, follow the instructions and standards of the respon-   sible authorities or the builder of the structural member.   Reinforcementrodsmustbecutintheprescribedsequence   and in accordance with applicable safety regulations.   - Synthetic resin cutting discs can absorb moisture. This   moisture can cause the disc to become unbalanced at high   speed. This imbalance can cause the disc to break.   - Do not cool resin cutting discs with water or other fluids.   - Do not expose resin cutting discs to high humidity or   rain!   Do not use resin cutting discs past their use-by date (expira-   tion date)! The date (quarter and year) is stamped on the disc’s   arbor ring.   NOTE:   Mortar,stone,andconcretedeveloplargequantitiesofdustduring   cutting. To increase the lifetime of the cutting disc (by cooling),   to improve visibility, and to avoid excessive dust creation, we   strongly recommend wet cutting instead of dry cutting.   EXAMPLE: 04 / 2007   This cutting disc can be used through the end of the fourth quarter   of ꢁ007, if properly stored and correctly used.   Cutting metals   IMPORTANT!   Always wear approved respiratory protection!   Materials that can release toxic substances may be cut only   after notifying the proper authorities and under their supervi-   sion or that of a person appointed by them.   CAUTION!   The rapid rotation of the cutting disc heats metal and melts it   at the point of contact. Swing the guard as far down as pos-   sible (ꢀ9) in order to direct the stream of sparks forward, away   from the operator (fire hazard).   - Determine the cut line, mark the cut and apply the disc to the   material at moderate speed, to cut a guide groove before going   to top speed and applying more pressure to the Power Cut.   ꢀ9   - - Keep the disc straight and vertical. Do not tip it, as this can   break it.   The best way to get a good, clean cut is to pull or move the   Power Cut back and forth. Do not simply press the disc into   the material.   - - Thick round stock is best cut in stages (ꢁ0).   Thin tubing and pipes can be cut with a simple downward   cut.   - Cut large-diameter pipes as for round stock. To prevent tipping   and for better control, do not let the disc sink too deeply into   the material. Instead, always cut shallow around the whole   piece.   - Worn discs have a smaller diameter than new discs, so that at   the same engine speed they have a lower effective circumfer-   ential speed and therefore do not cut as well.   ꢁ0   - - Cut I-beams and L-bars in steps; see Figure ꢁꢀ.   Cut bands and plates like pipes: along the wide side with a long   cut.   - Whencuttingmaterialunderstress(supportedmaterialormate-   rial in structures), always make a notch in the thrust (pressure)   side, and then cut from the tension side, so that the disc does   not lock in. Secure cutoff material from falling!   CAUTION!   If there is a chance that the material is under stress, be pre-   pared for it to kick back. Make sure you can get out of the   way if you have to!   Be particularly careful in scrap-metal yards, junkyards, at ac-   cidentsites,andwithhaphazardpilesofmaterial.Precariously   balancedpiecesorpiecesunderstresscanactinunpredictable   ways, andmayslide, jumpout, orburst. Securecutoffmaterial   from falling! Always exercise extreme caution and use only   equipment that is in perfect working order.   ꢁꢀ   Observetheaccident-preventionrulesandregulationsofyour   employer and/or insurance organization.   9 Download from Www.Somanuals.com. All Manuals Search And Download.   In wet cutting, the disc is wetted at an equal rate on both sides by   a trickle of water. MAKITA offers the right accessories for all wet   cutting applications (see also "SPECIAL ACCESSORIES").   - Remove foreign objects such as sand, stones and nails found   withintheworkingarea.Caution:Watchoutforelectricwires   and cables!   The rapid rotation of the cutting disc at the point of contact   throws fragments out of the cut groove at high speed. For   your safety, swing the protection hood down as far as pos-   sible (ꢁꢂ), so that material fragments are thrown forward,   away from the operator.   ꢁꢂ   - Mark the cut, and then make a groove about 5 mm (just under   ꢀ/5") along the entire length of the planned cut. This groove will   then guide the Power Cut accurately guring the actual cutoff.   NOTE:   For long, straight cuts we recommend using a trolley (ꢁ4, see   also "SPECIAL ACCESSORIES"). This makes it much easier to   guide the unit straight.   - - Perform the cut with a steady back-and-forth motion.   When cutting slabs to size, you need not cut through the entire   materialthickness(creatingunnecessarydust).Instead,simply   make a shallow groove, and then knock off the excess material   cleanly on a flat surface (25).   CAREFUL!   Whencuttingintolengths,cuttingthroughmaterial,makingcutouts,   etc., always make sure to plan the direction and sequence of cuts   in such a way that the disc does not get jammed by the cut-off   piece, and that no persons can be injured by falling pieces.   Transport and storage   - - - Always turn off the Power Cut when transporting it or   moving it from place to place on a site (ꢁ6).   ꢁ4   Never carry or move the unit with the engine on or the   disc moving!   Carry the unit only by the tubular (middle) handle with the cut-   ting disc pointing behind you (ꢁ6). Avoid touching the exhaust   muffler (burn hazard!)   - - When moving the Power Cut over longer distances, use a   wheelbarrow or wagon.   When transporting the Power Cut in a vehicle, make sure it is   securely positioned in such a way that no fuel can leak out.   Always remove the cutting disc before transporting the unit in   a vehicle. Before transporting in a vehicle, allow the Power Cut   to cool off completely. Note: Mufflers with catalytic converters   take longer to cool off!   - - The Power Cut should be stored safely in a dry place. It must   not be left outdoors! Always dismount the cutting disc before   storage. Keep the Power Cut away from children.   ꢁ5   Before long-term storage and before shipping the Power   Cut, follow the instructions in the chapter on "Periodic   care and maintenance". ALWAYS empty the fuel tank and   run the carburetor dry.   - When putting cutting discs in storage, be careful to:   • Cleananddrythemwell.CAUTION:DoNOTcleansynthetic   resin cutting discs with water or other fluids!   Store them lying down flat.   • • Avoid dampness, freezing temperatures, direct sunshine,   high temperatures and temperature fluctuations, as these   can cause breakage and splintering.   • Before re-using a resin cutting disc, make sure of the use-by   (expiration) date (quarter and year, stamped on the arbor   ring). If this date has been exceeded, do NOT use the cutting   disc.   - Always check new cutting discs or cutting discs that have   been in storage to make sure that they are free of defects   and before the first cut test-run the tool at top speed for at   least 60 seconds. Keep body parts and people well away out   of range of the direction of the cutting disc during this test.   ꢁ6   ꢀ0   Download from Www.Somanuals.com. All Manuals Search And Download.   Maintenance   - - - Beforeperformingmaintenanceworkswitchoffthe Power   Cut (ꢁ7) and pull out the plug cap.   Allow the Power Cut to cool off before doing any mainte-   nance work (burn hazard)!   Always check the Power Cut before using it to make sure that   it is in good working order. In particular, make sure that the   cutting disc is properly mounted. Make sure that the cutting   wheel is undamaged and suitable for the job it will be used   for.   - Operate the Power Cut only at a low noise and emission level.   For this ensure the carburetor is adjusted correctly.   ꢁ7   ꢁ8   ꢁ9   - Do not operate the Power Cut with a defective or modified   muffler.   - - Clean the Power Cut regularly.   Check the fuel tank cap regularly for good sealing.   Observe the accident prevention instructions issued by   trade associations and insurance companies. NEVER   make any modifications to the Power Cut! You will only   be putting your own safety at risk!   Perform only the maintenance and repair works described in   the instruction manual. All other work must be carried out by   MAKITA Service.   SERVICE   Use only original MAKITA spares and accessories.   The use of non-MAKITA spares, accessories, or cutting discs   increases the risk of accident. We cannot accept any respon-   sibility for accidents or damage occurring in association with   the use of cutting discs or accessories other than original   MAKITA.   First aid   For the event of a possible accident, please make sure that a   firstaidkitisalwaysimmediatelyavailablecloseby.Immediately   replace any items used from the first aid box.   When calling for help, give the following information:   - Place of the accident   - What happened   - Number of injured people   - Kind of injuries   - Your name!   NOTE   Individuals with poor circulation who are exposed to excessive   vibration may experience injury to blood vessels or the nervous   system.   Vibration may cause the following symptoms to occur in the fin-   gers, hands or wrists: ”Falling asleep” (numbness), tingling, pain,   stabbing sensation, alteration of skin colour or of the skin. If any   of these symptoms occur, see a physician!   Disposal and environmental protection   Be mindful of the environment!   Dispose of worn-out or defective cutting discs in accordance with   your local disposal regulations. To protect unusable cutting discs   from misuse, destroy them before disposal.   When the Power Cut is worn out or damaged beyond repair, have   it disposed of or recycled in an environmentally sound manner. If   necessary, consult your local authorities.   ꢀꢀ   Download from Www.Somanuals.com. All Manuals Search And Download.   Technical data   DPC7311HD, DPC7321HD   Displacement   Bore   cu in (cmꢂ)   in (mm)   in (mm)   hp (kW)   Nm   4,5 (7ꢂ)   ꢀ,97 (50)   ꢀ,46 (ꢂ7)   5,6 (4,ꢁ)   5,0   Stroke   Max. power   Max. torque   Idling speed   rpm   rpm   ꢁ.500   ꢂ.800   Clutch engagement speed   Engine speed limitation   rpm   rpm   9.ꢂ50   4.ꢂ00   Max. spindle speed   Sound pressure level at the operators ear ꢀ)   Sound pressure level at the bystander’s position (50 ft)ꢀ)   Vibration acceleration ah,w per EN ꢀ454   - Tubular handle (idle/rated spindle speed)   - Rear handle (idle/rated spindle speed)   Carburetor (diaphragm carburetor)   Ignition system (with speed limitation)   Spark plug   dB (A)   dB (A)   ꢀ04   86   m/sꢁ   m/sꢁ   Type   7 / 6   8 / 7   WALBRO WJ-ꢀ05   electronic   Type   Type   NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y   Electrode gap   in (mm)   kg/h   .0ꢁ0 (0,5)   ꢁ,ꢀ   500   Fuel consumption at max. load per ISO 889ꢂ   Specific consumption at max. load per ISO 8893   Fuel tank capacity   g/kWh   fl oz (l)   37 (1,1)   Mixture ratio (fuel/two-stroke oil)   - when using MAKITA oil   50:ꢀ   ꢀ4" / ꢀ" / 0.ꢁ" ꢂ)   Cutting disc for 80 m/sec. ꢁ)   Arbor diameter   in   ꢂ)   in   ꢀ"   V-belt   Overall weight (tanks empty, without cutting disc )   part no.   lb   965 ꢂ00 470   ꢁꢁ.04   ꢀ) According to UL-test requirement under full load (cutting concrete).   ꢁ) Circumference speed at max. engine speed   ꢂ) Outside diameter / arbor hole / thickness   3 4 5 6 7 Denomination of components   Identification plate (ꢀꢁ)   DPC7311   Indicate when ordering spare parts   2004 123456   2 26   Serial number   22045 Hamburg, Germany   Year of manufacture   1 394.100.641   Typ 394   8 1 2 3 4 5 6 7 8 9 Handle   Filter cover for air filter and spark plug cap   Cover lock   Tubular handle   Muffler   Protection hood   Grip   V-belt tension adjusting screw   Retaining nuts   9 13   12   11   10   14 15   16   10 Stand   11 Carburetor adjustment opening   12 Identification plate   13 Fuel tank with handle   14 Decompression valve   15 Starter grip   25   24   17   16 Air intake   17 Combination Start/Stop (I/O) switch, choke   18 Stop knob for halfway throttle   19 Safety locking button   20 Throttle lever   18   19   23   21 Tank cap (fuel)   22 Starter housing with starter   23 Cutting disc   24 Disc bolt   20   25 Spring washer   26 Hold opening   22   21   ꢀꢁ   Download from Www.Somanuals.com. All Manuals Search And Download.   PUTTING INTO OPERATION   CAUTION:   Always turn off the engine and pull off the spark plug cap   before doing any work on the Power Cut! Always wear   protective gloves!   CAUTION:   Start the Power Cut only after complete assembly and   inspection.   A For the the following work, use the assembly tools included   with delivery:   ꢀ. ꢀꢂ/ꢀ9 AF combination wrench   ꢁ. Allen key   ꢂ. Carburetor adjustment screwdriver   Place the Power Cut on a stable surface and carry out the fol-   lowing assembly steps:   1 2 3 B Schematic drawing   7 Mounting the cutting disc   Inspect the disc for damage.   See SAFETY INSTRUCTIONS, Page 6.   Unscrew screw (9) and remove the spring washer (8).   Place the cutting disc (5) on the arbour (7).   5 NOTE: The arbor hole of the cutting disc must be an exact fit   with the arbor or shaft.   5 7 8 9 Make sure the cutting disc is installed so it turns in the right   direction, if a direction is marked on the disc.   C Place the spring washer (8) on the arbour and insert the screw   (C/9) and tighten by hand.   Turn the disc slowly until the stop hole of the V-belt pulley is   visible in the cutting arm cover (10).   8 1 10   2 Insert the Allen key (2) as far as it will go. The shaft is now   blocked.   Tighten the screw with the combination wrench (1)   NOTE: Tighten the screw firmly (30 ± 2 Nm), as otherwise   the cutting wheel may slip during cutting.   D ꢀꢂ   Download from Www.Somanuals.com. All Manuals Search And Download.   Tightening the V-belt / Checking V-belt tension   IMPORTANT:   Exact V-belt tension is essential for maximum cutting per-   formancewithminimumfuelconsumption. ImproperV-belt   tensionwillresultinprematureweartotheV-beltandV-belt   wheel or damage to the clutch bearing.   If the Power Cut is new or the V-belt has been replaced,   retighten the V-belt after the first hour of operation!   E NOTE: The two fastening nuts (11) must be loosened before   tightening the V-belt or checking the tension.   To increase the belt tension, turn the tightening screw (12) to   the right (clockwise) with the combination wrench included with   the Power Cut.   Thebelttensioniscorrectlyadjustedwhenthenut(13)iscenterd   on the mark (14).   13   IMPORTANT:   11   12   After tightening/inspection, make certain to tighten   the fastening nuts (11) (30 ± 2 Nm).   14   F Fuels   Caution:   The Power Cut uses mineral-oil products (gasoline and oil).   Be especially careful when handling gasoline.   Do not smoke. Do not allow gasoline to come near flames,   sparks or fire (explosion hazard).   50:1   Gasoline   Fuel mixture   The Power Cut is powered by a high-performance two-stroke   engine. It runs on a mixture of gasoline and two-stroke engine   oil.   OIL   + 50:1   The engine is designed for unleaded regular gasoline with a   min. octane value of 9ꢀ ROZ. In case no such fuel is available,   you can use fuel with a higher octane value. This will not affect   the engine.   ꢀ.0 Us-gal. (3.7 l)   ꢁ.5 Us-gal. (9.4 l)   5.0 Us-gal. (18.9 l)   2.6 floz. (75 cmꢂ)   6.4 floz. (189 cmꢂ)   12.8 floz. (378 cmꢂ)   In order to obtain an optimum engine output and to pro-   tect your health and the environment use unleaded fuel   only. Gasoline which contens alcohol should not used in   MAKITA products.   The correct mixture ratio:   To lubricate the engine, use a high-performance two-stroke   engine oil (quality grade JASO FC or ISO EGD specifications),   which is added to the fuel.   50:1 When using MAKITA high-performance two-   stroke engine oil, i. e. 50 parts gasoline to ꢀ   part oil.   G ꢀ4   Download from Www.Somanuals.com. All Manuals Search And Download.   MAKITA HP ꢀ00 high-performance two-stroke engine oil is   available in the following sizes to suit your individual require-   ments:   The Storage of Fuel   Fuels have a limited storage life. Fuel and fuel mixtures   age through evaporation, especially at high temperatures.   Aged fuel and fuel mixtures can cause starting problems   and damage the engine.Purchase only that amount of fuel,   which will be consumed over the next few months. At high   temperatures, once fuel has been mixed it should be used   up in 6-8 weeks.   0,5 l order number 980 008 609   MAKITA high-performance two-stroke engine oil (50:ꢀ) is   available in the following sizes to suit your individual require-   ments:   ꢀ00 ml order number 980 008 606   ꢀ l order number 980 008 607   Use only approved and marked containers for transport   and storage. Store fuel only in dry, cool and secure   locations!   NOTE: For preparing the fuel-oil mixture first mix the entire oil   quantity with half of the fuel required, then add the remaining   fuel. Shake the finished mixture thoroughly before pouring it   into the Power Cut tank.   Caution: Open the tank cap carefully, as pressure might   have built up inside!   AVOID SKIN AND EYE CONTACT   It is not wise to add more engine oil than specified to   ensure safe operation. This will only result in a higher   productionofcombustionresidueswhichwillpollutethe   environmentandclogtheexhaustchannelinthecylinder   as well as the muffler. In addition, fuel consumption will   rise and performance will decrease.   Mineral oil products degrease your skin. If your skin comes in   contactwiththesesubstancesrepeatedlyandforanextended   periodoftime,itwilldryout.Variousskindeseasesmayresult.   In addition, allergic reactions are known to occur.   Eyes can be irritated by contact with oil. If oil comes into your   eyes, immediately wash them with clear water.   If your eyes are still irritated, see a doctor immediately!   A Refuelling   IMPORTANT:   FOLLOW THE SAFETY PRECAUTIONS!   Be careful and cautious when handling fuels.   The engine must be turned off and cooled down!   Carefully clean the area around the fuel-tank filler neck to keep   dirt from getting in the tank.   Place the unit on its side on an even surface.   Unscrew the tank cap and fill tank with fuel mixture. Take care   to avoid spilling.   Screw the tank cap back on hand-tight.   After refuelling, clean screw cap, tank and check for   lekages.   Fuel mixture   Never start or operate the Power Cut in the same place as   it was fuelled!   If fuel gets on your clothing, change clothes immediately.   B ꢀ5   Download from Www.Somanuals.com. All Manuals Search And Download.   Starting the engine   1 if   necessary   This model is fitted with a semiautomatic decompression valve   (1) to make starting easier. Depressing it reduces the force   needed for compression, so little force is needed to accelerate   the engine to its starting speed.   The high pressure in the combustion chamber after the first   ignition automatically closes the decompression valve (button   pops out).   C 2 1 CAUTION:   Observe the SAFETY INSTRUCTIONS on page 4 and 5!   Start the Power Cut only after complete assembly and   inspection!   Move at least 3m (ꢀ0 feet) away from the place where you   fuelled the Power Cut.   3 meters (10 feet)   Make sure you have a good footing, and place the Power   Cut on the ground in such a way that the cutting disc is   not touching anything.   D E F 2 3 Move the protective hood (3) into the proper position for the   work you intend to do (see illustration).   Grasp the grip (2). The hood (3) can swing in both ways within   its range of motion.   Caution:   4 Alwaysmakesurethatthestraightouteredgeoftheimpactplate   (4) and the edge of the hood are parallel (see arrows).   If this is not the case, take the tool to a service center.   Cold-starting   5 6 7 8 Move the combination switch (6) up (choke position).   Grasp handle (hand pressure actuates the grip throttle lever   lock (8)).   Push the throttle (9) in all the way and hold it.   Press the throttle lock (7) and release the throttle (9) (the throttle   lock will hold the throttle at half-throttle position).   NOTE: If the Power Cut is in a trolley, bring the control lever to   the third or fourth detent.   9 Depress decompression valve (5).   ꢀ6   Download from Www.Somanuals.com. All Manuals Search And Download.   Grasp the tubular handle firmly with one hand and press the   Power Cut against the ground.   Place the tip of your left foot in the rear handle.   Pull the starter cable strong and rapidly until you hear the   first audible ignition.   CAUTION: Do not pull out the starter cable more than approx.   50 cm, and lead it back by hand.   Depress decompression valve (F/5) again.   Put the combination switch (F/6) in position “I”.   Keep pulling the starter cable until the engine catches.   As soon as the engine is running, press the throttle (F/9) to   release the half-throttle lock (F/7), allowing the engine to idle.   Warm-starting   As described under ”Cold starting”, except without putting the   combination switch (F/6) in choke position.   G Stopping the engine   Push the combination switch (1) down to position   . STOP   10   H ꢀ7   Download from Www.Somanuals.com. All Manuals Search And Download.   Adjusting   the carburetor   NOTE: The grinding parts are equipped with an electronic   ignition to limit the speed.   At the factory the idling speed has been set to approx.   2,500 1/min., but the running-in process of a new engine   may require slight readjustment of the idling speed.   A For correct adjustment of the idling speed the following   steps must be carried out:   Start the engine and run it until it is warm (about ꢂ - 5   minutes).   2 1 B Adjust the carburetor with the screwdriver (1, Order No. 944   ꢂ40 00ꢀ) included with the Power Cut. It has a lug that helps   with adjustment.   1 Readjust the idling speed.   If the cut-off disc is still turning when the engine is running,   unscrew the adjusting screw of the throttle valve (2) until the   cut-off disc is no longer turning. When the engine is left running   at idling speed, loosen the screw a little.   Switch off the engine.   2 C ꢀ8   Download from Www.Somanuals.com. All Manuals Search And Download.   MAINTENANCE   CAUTION:   BeforedoinganyworkonthePowerCutturnofftheengine,   remove the cutting disc, pull the plug cap off the spark plug   and wear protective gloves!   CAUTION:   Start the Power Cut only after complete assembly and   inspection.   A B C D IMPORTANT:   Because many of the parts and assemblies not mentioned   in this Instruction Manual are vital to the safety of the unit,   and because all parts are subject to a certain amount of   wear and tear, it is important for your own safety that you   havetheunitcheckedandmaintainedregularlybyaMAKITA   service center.   IMPORTANT:   SERVICE   If the cutting wheel breaks during cutting, the   Power Cut must be repaired by a MAKITA service   center before being used again!   4 3 7 5 6 Changing the V-belt   Loosen nuts (3).   Loosen the tightening screw (1) (counter-clockwise) until the   end of the screw (2) is visible in the gap.   Unscrew the nuts (3) and remove the cover (4).   Remove the screws (5) and (7) and remove the side piece (6).   NOTE:   Screw (5) is longer than screws (7). Make sure   to put them back in the right places during reas-   sembly!   2 1   Unscrew the screws (8) and remove the crankcase housing   cover (9).   8 9 Remove the old belt (10) or belt pieces.   Clean out the inside of the drive arm with a brush.   Put in a new V-belt.   NOTE:   Reassemble the crankcase housing cover (9), side piece (C/6)   and cover (C/4) in the reverse order.   10   To tighten the V-belt see ”Tightening the V-belt / Checking   V-belt tension”.   ꢀ9   Download from Www.Somanuals.com. All Manuals Search And Download.   Cleaning the protection hood   Over time, the inside of the protective hood can become caked   with material residue (especially from wet cutting), which if   allowed to accumulate can hinder the free rotation of the cut-   ting disc. For this reason the hood must be cleaned out from   time to time.   Take off the cutting wheel with spring washer and remove the   accumulated material from inside the hood with a strip of wood   or similar implement.   NOTE: To install the cutting wheel see ”Mounting the cutting   wheel”.   Clean the shaft and all removed parts.   E Cleaning / changing the air filter   11   12   Turn the cover lock (11) to the ”Unlocked   carefully remove the filter cover (12).   ” position and   There are two O-rings (G/15) between the filter cover (12) and   the air filter hood (G/14).   F Remove screws (13) and take off the cover (14).   Clean the O-ring (15) with a brush and inspect for damage.   14   13   15   G 16   Take the pre-filter (foam, 17) out of the filter cover.   Pull the air filter insert (paper cartridge, 18) out of the cover.   Remove the inner filter (16) from the intake opening.   Note:   Do not allow dirt to get into the carburetor!   17   Switch the combination switch to ”Choke” or cover the carbure-   tor with a clean cloth.   18   H ꢁ0   Download from Www.Somanuals.com. All Manuals Search And Download.   Pre-filter (foam) and inner filter   CAUTION:   Never clean out the air filter with compressed   air! Do not clean the pre-filter and inner filter   with fual.   If the pre-filter (1) and inner filter (3) are dirty, wash them out in   lukewarm water with regular dishwashing liquid.   Dry pre-filter and inner filter thoroughly.   NOTE: The pre-filter needs cleaning at least daily, or more often   if the Power Cut is used in very dusty conditions. If cleaning on-   site is not possible, keep a replacement pre-filter on hand.   Replace the pre-filter after every 20 operating hours at the   latest.   To improve filtration, wet the pre-filter with air filter oil. Before   doing this, carefully clean the pre-filter with air filter cleaner. Be   sure to follow manufacturer’s instructions.   When inserting the pre-filter in the filter cover, align it with the   cover opening and press it into the cover (5).   5 4 1 Filter insert (paper cartridge)   The air filter insert (2) filters the intake air through a very fine   paper fan filter system, so it must never be washed. Clean the   filter insert once weekly.   To do so, open it slightly and carefully tap it out against a clean   surface.   Replace the filter insert every 100 operating hours. Replace it   immediately if there is loss in power, loss in speed, or smoke   develops in the exhaust.   2 3 Before installing the filter system, check the intake opening for   any dirt particles that may have fallen in. If so, remove them.   CAUTION:   If the air filter becomes damaged, replace immediately!   Pieces of cloth or large dirt particles can destroy the en-   gine!   A Replacing the spark plug   CAUTION:   6 7 Do not touch the spark plug or plug cap if the engine is   running (high voltage).   Switch off the engine before starting any maintenance   work.   A hot engine can cause burns. Wear protective gloves!   The spark plug must be replaced in case of damage to the   insulator, electrode erosion (burn) or if the electrodes are very   dirty or oily.   8 9 Turn the cover lock (6) to the ”Unlocked ” position and care-   fully remove the filter cover (7).   Flip up the spark-plug cover (8).   0,5 mm   Pull theplug cap (8)offthespark plug. Use only thecombination   wrench supplied with the saw to remove the spark plug.   Electrode gap   The electrode gap must be 0.5 mm.   B ꢁꢀ   Download from Www.Somanuals.com. All Manuals Search And Download.   Checking the ignition spark   Insert the combination wrench (9) between the hood and cyl-   inder only as shown.   STOP   CAUTION!   11   Do not insert the combination tool into the spark plug hole,   but make contact only with the cylinder (otherwise you may   damage the engine).   10   9 Using insulated pliers, hold the spark plug (10) (unscrewed but   with the plug cap on) against the combination tool (away from   the spark plug hole!).   Switch the combination switch (11) to ”I”.   Pull the starter cable hard.   If the function is correct, an ignition spark must be visible near   the electrodes.   CAUTION: Use only BOSCH WSR 6F spark plug, CHAMPION   RCJ-6Y or NGK BPMR 7A.   E Replacing the suction head   The felt filter (13) of the suction head can become clogged.   It is recommended to replace the suction head once every   three months in order to ensure unimpeded fuel flow to the   carburetor.   Unscrew the tank cap (12), pull the retainer out of the opening.   Empty fuel tank.   Use a wire hook to pull the suction out of the tank opening for   replacement.   Caution: Do not allow fuel to come into contact with skin!   13   12   F Replacing the starter cable   14   15   B Remove four screws (14). Remove starter housing (15).   18   Unscrew two screws (16) and carefuly remove the air guide   (17) from the starter housing (15). Proceed in the order (A - B   - C - D).   A 16   17   D Remove all pieces of cable (18).   C G Thread in a new starter cable (dia 4.0 mm, length ꢀ000 mm) as   shown (don’t forget the disc (19)) and knot both ends.   21   Pull knot (20) into the cable pulley (21).   20   CAUTION: Do not let the knots or the cable ends protrude from   the outside of the cable pulley.   Pull knot (22) into the cable grip (23).   23   22   19   H ꢁꢁ   Download from Www.Somanuals.com. All Manuals Search And Download.   Guide the cable into the recess (24) on the cable drum and   use the cable to turn the drum two turns in the direction shown   by the arrow.   Holdingthecabledruminyourlefthand,straightenoutthetwistin   the cable with your right hand, pull the cable tight, and hold.   Release the cable drum. The drum´s spring force will now wind   the cable around the drum.   Repeat three times. The starter grip must be upright on the   starter housing.   NOTE: With the cable pulled all the way out, it must still be   possible to turn the pulley another ꢀ/4 turn against the return   spring.   24   CAUTION!   Injury hazard! When you pull out the starter cable hold the   starter handle firmly. It will whip back if the cable pulley is   released by accident.   26   Install the air guide in reverse order (see figure G, page 21).   Make sure that the nub (25) fits into the slot (26) in the starter   housing.   When putting the starter housing back on, it may be necessary   to pull the starter handle slightly until the starting mechanism   engages.   25   A Replacing the return spring   Remove the starter housing (see “Replacing the starter cable”).   Take the air guide off the starter housing (see “Replacing the   starter cable”).   Take off circlip (1) (circlip pliers, see “Accessories”).   Remove the cable pulley (2).   Unscrew screw (3).   Evenly lever the return spring (4) out of the catch using a   screwdriver or similar tool. Be extremely careful - the return   spring is under tension and can pop out of its housing!   5 CAUTION! Injury hazard! Wear eye protection and work   gloves when performing this work!   4 Replacement return springs are delivered already tensioned in   the housing. CAREFUL - the spring can pop out. If it does,   it can be put back in as shown in the diagram (observe the   direction of rotation).   3 2 Before installing the new return spring (4) in the starter hous-   ing, grease it lightly with multipurpose grease, Order No. 944   ꢂ60 000. Then position it and press it until the tabs (5) engage   in the slots.   1 Do not grease the cable drum (2) or bearing journal!   Screw in bolt (3) but do not tighten it hard.   Turn the cable pulley slightly when putting it back on, until you   hear it catch. Put the circlip back on.   Wind on the starter cable (see above under “Replacing the   starter cable”).   Reinstall the air guide (see Fig. A)   When putting the starter housing back on, it may be necessary   to pull the starter handle slightly until the starting mechanism   engages.   B ꢁꢂ   Download from Www.Somanuals.com. All Manuals Search And Download.   Cutting attachment in   central / side position   NOTE: The Power Cut is delivered with the cutting attachment   mounted in the middle position (1). For cutting up against ob-   stacles, such as curbs or walls, the cutting attachment can be   mounted to one side (2). Use this position only when actually   necessary, and afterwards return the cutting attachment to the   middleposition.InthispositionthePowerCuthasbetterbalance,   is easier to guide, and is not as fatiguing for the operator.   1 2 C 7 5 Repositioning the cutting attachment   Loosen nuts (5).   6 Loosen the tightening screw (3) (counter-clockwise) until the   end of the screw (4) is visible in the gap.   Unscrew the nuts (5) and remove the cover (6).   4 3 D Use the combination tool (8) to lever out the stop pin (7) as   shown in the illustration, until the protective hood (ꢀ0) can be   turned.   NOTE: The turn stop (D/7) is deactivated when the stop pin   (7) is removed. This permits the hood (10) to be turned farther   than the turn stop (D/7).   Unscrew the grip (9) and turn the protective hood (10) as shown   in the illustration.   9 10   Disengage the V-belt (11) and remove the cutting attachment.   7 8 11   E ꢁ4   Download from Www.Somanuals.com. All Manuals Search And Download.   Press the cutting attachment (12) onto the drive arm in the   side position.   Guide the V-belt (13) over the V-belt pulley (14).   12 14 13   F Put the guard plate (15) on.   17   Screw on nuts (16) and tighten by hand.   To tighten the V-belt see ”Tightening the V-belt / Checking V-   belt tension”.   Tighten the nuts (16) firmly with the combination wrench.   Replace the grip (17) as shown.   IMPORTANT:   When you reposition the cutting attachment, the direction   of rotation of the cutting wheel changes.   15   16   If a rotation direction is marked on the cutting disc, make   sure the disc turns in the right direction.   G Replacing/cleaning the spark arrester screen   Models without catalytic converter   The spark arrester screen should be checked and cleaned   regularly.   20   Models without catalytic converter   Loosen the ꢁ screws (19) and remove the spark arrester   screen (20).   19   Models with catalytic converter   Models with catalytic converter   Unscrew and remove screws (21). Remove the front housing   section of the muffler (22).   Unscrew and remove screw (23). Remove the deflector plate   and spark arrester screen (24).   CAUTION:   23 24   21   22   Do not use sharp or pointed objects for screen cleaning.   Damaged or misformed screen wires may result.   Reassembly the spark arrester screen and tighten the screws.   Information on the catalytic converter: The catalytic converter   reduces the pollutant content of the exhaust.   ꢁ5   Download from Www.Somanuals.com. All Manuals Search And Download.   SPECIAL ACCESSORIES   Diamond cutting discs (ꢀ)   Water tank (5)   The water tank is designed to be mounted on the guide trol-   ley. Its high capacity makes it especially suitable for situations   involving frequent site changes. For filling or for fast changing   to reserve tanks, the tank can be simply lifted off the trolley.   MAKITA diamond cutting discs meet the highest demands   in working safety, ease of operation, and economical cut-   ting performance. They can be used for cutting all materials   except metal.   The water tank comes with all necessary connections and   hoses. Mounting to the trolley and Power Cut are very fast   and simple.   The high durability of the diamond grains ensures low wear   and thereby a very long service life with almost no change in   disc diameter over the lifetime of the disc. This gives consistent   cutting performance and thus high economy. The outstanding   cutting qualities of the discs make cutting easier.   The metal disc plates give highly concentric running for minimal   vibration during use.   Mains/pressure water system (6)   The mains/pressure water system is designed to be mounted   on the Power Cut. It can be used with or without the trolley,   but is especially suitable for applications involving hand-held,   stationarycutting.Thewaterlinehasafast-releaseconnection,   and can be fed either from a mains supply or from a pressure   tank (7).   The use of diamond cutting discs reduces cutting time sig-   nificantly. This in turn leads to lower operating costs (fuel   consumption, wear on parts, repairs, and last but not least   environmental damage).   The water system comes with all necessary connections   and lines. It can be quickly and easily mounted on the Power   Cut.   See “Accessories” for order number.   Guide trolley (ꢁ)   The MAKITA guide trolley makes it much easier to do straight   cuts,whilesimultaneouslyenablingalmostuntiringworking.Itcan   be adjusted for the operator´s height, and can be operated with   the cutting attachment mounted in the middle or on the side.   For easier refuelling when using the trolley, we recommend   adding an angled tank filler neck (3).   A depth limiter can be added for still easier and more accurate   cutting. Itmakesitpossible tomaintainaprecisepredetermined   cut depth (4).   To keep down dust and for better cutting-disc cooling, MAKITA   offers several options for wetting the disc during operation.   5 2 4 1 7 6 3 ꢁ6   Download from Www.Somanuals.com. All Manuals Search And Download.   Instructions for periodic maintenance   To ensure long life, prevent damage and ensure the full functioning of the safety features the following maintenance must be per-   formed regularly. Guarantee claims can be recognized only if this work is performed regularly and properly. Failure to perform the   prescribed maintenance work can lead to accidents! Users of the Power Cut must not perform any maintenance work not described   in this Instruction Manual. All such work must be carried out by a MAKITA service center.   Page   General   Entire Power Cut   Clean exterior, check for damage. In case of damage,   have repaired by a qualified service center immediately   Cutting disc   Clutch   Inspect regularly for damage and wear.   Have inspected at a service center.   Clean, Check position (impact plate)   7 Protection hood   ꢀ6   7 Before each start   Cutting disc   Inspect for damage and make sure the cutting wheel is   right for the job   V-belt   Check V-belt tension   Adjust position   ꢀ4   Protective hood   Combination switch,   Safety locking button,   Throttle lever   Functional check   Functional check   Functional check   ꢀ6   Tank cap   Check for tightness and lekages   Every day   Air filter   Clean, (poss. more often), replace foam pre-filter after   ꢁ0 hours of operation   ꢁ0   ꢀ8   Idle speed   Check (cutting disc must not turn on idle)   Every week   Starter housing   Starter cable   V-belt   Clean to ensure proper air cooling   Check for damage   ꢀꢁ   ꢁꢁ   Check V-belt tension, inspect for damage and wear   Clean, replace after ꢀ00 operating hours   Check and replace if necessary   ꢀ9   Air filter insert   Spark plug   Muffler   ꢁꢀ   ꢁꢀ-ꢁꢁ   Check tightness of mounting, clean or replace spark arrester 13 / 28   screen if necessary   Check their condition an that they are firmly secured   Screws an nuts   Every 3 months   Suction head   Fuel tank   Replace   Clean   ꢁꢁ   ꢀꢂ   Annually   Storage   Entire Power Cut   Entire Power Cut   Check at an authorized service center   Clean exterior, check for damage. In case of damage,   have repaired by a qualified service center immediately   Cutting disc   Fuel tank   Remove and clean   Empty and clean   Run empty   Carburetor   Service, spare parts and guarantee   Maintenance and repair   The maintenance and repair of modern cutoff saws and their safety-related components requires qualified technical training and a   workshop equipped with special tools and testing devices.   We therefore recommend that you consult a MAKITA service center for all work not described in this instruction manual.   The MAKITAservice centers have all the necessary equipment and skilled and experienced personnel, who can work out cost-effective   solutions and advise you in all matters.   Please contact your nearest service center or the general trading company or importer (see last page), who will gladly provide you   with the address of your nearest MAKITA service center.   Spare parts   Reliable long-term operation, as well as the safety of your Power Cut, depend among other things on the quality of the spare parts   used. Use only original MAKITA parts, marked   Only original parts are from the same production line as the original unit and therefore ensure the highest possible quality of materi-   als, dimensions, functioning and safety.   Only original spare parts and accessories guarantee the highest quality in material, dimensions and function.   Original spare parts and accessories can be obtained from your local dealer. He will also have the spare part lists to determine the   required spare part numbers, and will be constantly informed about the latest improvements and spare part innovations. To find your   Please bear in mind that if parts other than original MAKITAspare parts are used, this will automatically invalidate the MAKITAproduct   guarantee. We will furthermore not accept any liability damages arising from the use of non-MAKITA spare parts.   ꢁ7   Download from Www.Somanuals.com. All Manuals Search And Download.   Guarantee   MAKITA guarantees the highest quality and will therefore reimburse all costs for repair by replacement of damaged parts resulting   from material or production faults occurring within the guarantee period after purchase. Please note that in some countries particular   guarantee conditions may exist. If you have any questions, please contact your salesman, who is responsible for the guarantee of   the product.   Please note that we cannot accept any responsibility for damage caused by:   • • • • • • • • • • • • • Disregard of the instruction manual.   Non-performance of the required maintenance and cleaning.   Incorrect carburetor adjustment.   Normal wear and tear.   Obvious overloading due to permanent exceeding of the upper performance limits.   The use of other than original MAKITA cutting discs.   Use of force, improper use, misuse or accidents.   Damage from overheating due to dirt on the fan housing.   Work on the Power Cut by unskilled persons or inappropriate repairs.   Use of unsuitable spare parts or parts which are not original MAKITA parts, insofar as they have caused the damage.   Use of unsuitable or old oil.   Damage related to conditions arising from lease or rent contracts.   Damages caused by disregarding loose outer bolted connections.   Cleaning, servicing and adjustment work is not covered by the guarantee. All repairs covered by the guarantee must be performed   by a MAKITA service center.   Troubleshooting   Malfunction   System   Observation   Cause   Cutting disc does not   start turning   Clutch   Engine runs   Damage to clutch   Cutting disc runs in idle   Carburetor,   clutch   Cutting disc runs   Incorrect idle speed,   blocked clutch   Engine does not start or   only with difficulty   Ignition system   Ignition spark   No ignition spark   Fuel tank is filled   Inside   Malfunction in fuel supply system, com-   pression system, mechanical malfunction.   Switch on STOP, fault or short-circuit in the   wiring, plug cap or spark plug defective.   Fuel supply   Choke in wrong position, carburetor defective,   suction head dirty, fuel line bent or interrupted.   Compression   system   Cylinder base packing ring defective, radial   shaft packings defective, cylinder or piston rings   defective   Outside   Spark plug does not seal.   Mechanical   malfunction   Starter does not engage   Spring in starter broken, broken parts   inside the engine.   Warm start difficulties   Carburetor   Fuel supply   Fuel tank is filled   Fuel tank is filled   Wrong carburetor adjustment.   Ignition spark   Engine starts, but   dies immediately   Wrong idling adjustment, suction head or   carburetor dirty.   Tank venting defective, fuel line interrupted,   cable defective, STOP switch defective.   Decompression valve dirty   Insufficient power   Several systems   may be involved   simultaneously   Engine is idling   Air filter dirty, wrong carburetor adjustment,   muffler clogged, exhaust channel in cylinder   clogged, spark arrester screen clogged.   ꢁ8   Download from Www.Somanuals.com. All Manuals Search And Download.   Extract from the spare parts list   Use only original MAKITA parts. For repairs and   replacement of other parts, see your MAKITA service center.   DPC7311HD   DPC7321HD   Pos. MAKITA-No. Qty. Denomination   Synthetic resin cutting disc   ꢀ ꢀ 966 ꢀ44 ꢀ50   966 ꢀ44 ꢀꢁ0   ꢀ ꢀ Cutting disc for steel,   dia. ꢂ50/ꢁ5,4 mm (ꢀ4"/ꢀ.0")   Cutting disc for masonry,   dia. ꢂ50/ꢁ5,4 mm (ꢀ4"/ꢀ.0")   Hex screw M8xꢁ5   1 ꢂ 4 5 994 ꢁ80 ꢁ50   965 ꢂ00 470   96ꢂ 60ꢀ ꢀꢁ0   ꢀ ꢀ ꢀ 3 V-belt   10   Suction head   6 8 0ꢀ0 ꢀꢀ4 09ꢀ   394 173 020   ꢀ 1 Tank cap, compl. (fuel)   Inner filter   9 394 173 010   1 1 ꢀ ꢀ ꢀ ꢀ ꢁ ꢀ ꢀ ꢀ ꢀ ꢀ Air filter insert (paper cartridge)   Pre-filter (foam)   9 10 326 173 080   ꢀꢀ 965 60ꢂ 0ꢁꢀ   ꢀꢁ ꢀꢁꢁ ꢀ64 0ꢀ0   ꢀꢂ 00ꢀ ꢀ6ꢀ 0ꢁ0   ꢀ4 ꢂ94 ꢀ6ꢂ 0ꢁ0   ꢀ5 9ꢁꢂ ꢁ08 004   ꢀ6 94ꢀ 7ꢀ9 ꢀ40   ꢀ7 940 8ꢁ7 000   ꢀ8 944 ꢂ40 00ꢀ   ꢀ9 ꢂ94 ꢀ74 ꢀ40   ꢁ0 ꢂ94 ꢀ74 ꢂ40   Spark plug   8 20   11   19   Starter cable ø4,0xꢀ000 mm   Starter grip   12   13   Return spring in housing   Hexagonal nut M8   Universal wrench SW ꢀꢂ/ꢀ9   Offset screwdriver Tꢁ7   Screwdriver (carburetor)   Spark arrester screen cpl.   Spark arrester screen cpl.   (for models with catalytic converter)   14   6 5 15   4 16   17   18   Accessories (not delivered with the Power Cut)   25   Diamond cutting disc 14"/1.0"   ꢁꢁ 966 ꢁ44 0ꢁ0   ꢁꢁ 966 ꢂ44 0ꢁ0   ꢁꢁ 966 ꢁ44 0ꢀ0   ꢁꢁ 966 ꢂ44 0ꢀ0   24 010 114 081   ꢁ5 700 ꢂ94 ꢂ5ꢂ   ꢁ6 957 80ꢁ 600   ꢁ7 ꢂ94 ꢂ65 6ꢂ0   ꢁ8 ꢂ94 ꢀꢀ4 ꢁ70   ꢀ ꢀ ꢀ ꢀ 1 ꢀ ꢀ ꢀ ꢀ ꢀ Concrete Standard, dia. ꢂ50/ꢁ5,4 mm   Concrete DiaDuran, dia. ꢂ50/ꢁ5,4 mm   Asphalt Standard, dia. ꢂ50/ꢁ5,4 mm   Asphalt DiaDuran, dia. ꢂ50/ꢁ5,4 mm   Angle fuel-tank filler neck, cpl.   Guide trolley DTꢁ000 cpl.   Pressure water tank, cpl.   Mains water connection, cpl.   Stand with rollers, compl.   Combined can (for 5l fuel, ꢁ.5l oil)   - 949 000 0ꢂ5   24   27   26   22   (4x)   28   ꢁ9   Download from Www.Somanuals.com. All Manuals Search And Download.   ꢂ0   Download from Www.Somanuals.com. All Manuals Search And Download.   ꢂꢀ   Download from Www.Somanuals.com. All Manuals Search And Download.   To find your local distributor, please visit   Makita U.S.A., Inc.   ꢀ49ꢂ0 Northam Street   La Mirada,   CA 906ꢂ8-575ꢂ   Download from Www.Somanuals.com. All Manuals Search And Download.   |