| INSTALLATION AND   OPERATION INSTRUCTIONS   Solana™   EPA Low-Mass Wood-burning Fireplace Phase 2 Qualified   43" Wood-Burning Fireplaces   TM   P/N 506023-07 REV. B 06/2010   MODELS   SOLANA-BK   SOLANA-BN   This installation manual will enable you to obtain a safe, efficient   and dependable installation of your fireplace system. Please read   and understand these instructions before beginning your installation.   Do not alter or modify the fireplace or its components under any cir-   cumstances. Any modification or alteration of the fireplace system,   including but not limited to the fireplace, chimney components and   accessories,mayvoidthewarranty,listingsandapprovalsofthissystem   and could result in an unsafe and potentially dangerous installation.   Lennox Hearth Products wood-burning fireplaces are designed for use   as a supplemental heater. They are not intended for continuous use   as a primary heat source.   SAVE THESE INSTRUCTIONS   FOR FUTURE REFERENCE   WARNINGS   • The fireplace cannot be operated without doors   or firescreens. Consult your dealer to select the   correct replacement door(s) or firescreen(s).   WARNINGS   • Hot! Do not touch! The glass and   surfaces of this appliance will be hot   during operation and will retain heat   for a while after shutting off the appli-   ance. Severe burns may result.   • Carefully supervise children in the   same room as appliance.   • Important! To assure proper alignment of glass   doors: Install this fireplace in a square and   plumb condition, using shims as necessary at   sides and/or bottom.   • Install the fireplace only as described in these   instructions.   Listed to standards:   ULC-S610 & UL-127   ASTM 2558   Report No. 192-5237   PISOLANA REV. 2 06/2010   Download from Www.Somanuals.com. All Manuals Search And Download.   OPTIONAL EQUIPMENT   CONGRATULATIONS!   • Additional Equipment (optional)   - Trim Kit available in Nickel   - UZY5 blower   When you purchased your new fireplace, you joined the ranks of thousands of individuals   whose answer to their home heating needs reflects their concern for aesthetics, efficiency   and our environment. We extend our continued support to help you achieve the maximum   benefit and enjoyment available from your new fireplace.   - VRUW Blower motor speed control   - Forced Air Heating Kit   u Thank you for selecting a Lennox Hearth Products fireplace as the answer to your home   supplemental heating needs.   u Ifinstalled,thisappliancenolongerqualifies   for EPA Low Mass Wood-burning Fireplace   Program.   THE FIREPLACE   TABLE OF CONTENTS   INTRODUCTION   Safety Rules.......................................Page 2   Introduction .......................................Page 3   EPA WOOD-BURNING FIREPLACE   PROGRAM QUALIFIED   TheSolana,EPALow-MassWood-burningFire-   place Program qualified, is an energy efficient,   heat circulating fireplace. You will receive a   lifetime of comfort and enjoyment from your   fireplaceprovideditisinstalled,maintainedand   operated properly.   Parts Required ..................................Page 3   Optional Equipment............................Page 3   EPA Qualified .....................................Page 3   Operating The Fireplace .....................Page 4   Fuel....................................................Page 4   First Fires...........................................Page 4   Building a Fire....................................Page 4   Outside Air Register ..........................Page 5   Refueling............................................Page 5   Closing the Doors ..............................Page 5   Smoking – Causes And   Troubleshooting..............................Page 5   Important Cautions ............................Page 5   Maintaining Your Fireplace.................Page 6   Creosote.............................................Page 6   Chimney Maintenance........................Page 6   Dealing With A Chimney Fire..............Page 6   Top Baffle Removal ............................Page 6   Door Frame Care................................Page 6   Disposing of Ashes............................Page 6   Refractory Replacement.....................Page 7   Door Adjustment................................Page 7   How to use the retractable doors   and firescreens ...............................Page 7   Glass Care - Replacement..................Page 8   Glass Care - Cleaning.........................Page 8   Gasket Replacement .........................Page 8   Fireplace Installation .........................Page 8   Locating the Fireplace .......................Page 8   Preinstallation ...................................Page 9   Precautions........................................Page 9   Adjacent Wall .....................................Page 9   Enclosure / Chase ..............................Page 9   Mantel ...............................................Page 10   Hearth Extension Requirements ........Page 10   Cold Climate Installations ..................Page 10   Fireplace and Framing Dimensions ....Page 11   Insulated Chase Construction ...........Page 12   Fireplace Facing .................................Page 12   Outside Air Assembly ........................Page 13   UZY5 Blower Kit.................................Page 14   Forced Air Heating Kit .......................Page 14   Chimney System................................Page 15   Chimney Installation Instructions ......Page 16   Offset Chimney Installation................Page 17   Angled Wall Radiation Shield .............Page 19   Universal Roof Support......................Page 20   Chimney Chase And   This appliance has met the U.S. Environmental   Protection Agency (EPA) Low Mass Wood-   burning Fireplace Program Phase 2 emission   level (g/kg), as per test protocol ASTM 2558   "standard test method for determining particu-   late matter emissions from fires in low mass   wood-burning fireplaces".   • • Please read these instructions and retain   this manual for future reference.   Before beginning the fireplace installation,   consult the local authorities to obtain your   buildingpermitandcheckyourlocalbuilding   codes. Installthefireplaceonlyasdescribed   in these instructions and using only Lennox   Hearth Products components.   Fresh FireTM   Burn System   • TheSolanafireplaceisNOTintendedforuse   with an unvented gas log set. Do not use   a fireplace insert or any other product with   thisfireplaceunlessitisspecifiedbyLennox   for use with this appliance. Failure to follow   these instructions will void the certification   and the warranty of the fireplace and may   result in an unsafe installation.   1- Air is diverted under the front of the grate,   gainingheatfromtheemberandashmaterial   for more efficient combustion.   2- Cool air is deflected to prevent cooling   of the fire, so that high temperatures are   maintained.   3- Efficient combustion leads to lower emis-   sions,becausethehighertemperaturesburn   up more volatile gasses and particulates.   4- Exhaust air is effectively pulled into the   chimney, and heat from the fire is circulated   into the living space.   • These appliances are NOT approved for   Manufactured Home installations.   PARTS REQUIRED   Fireplace Model Solana   • 8"diameterchimney-ModelSecureTemp™   ASHT1",SecureTempS-2100+orACmanufac-   tured by Security Chimneys International only,   including:   4 - Chimney lengths   - Elbows (where necessary)   - Associated components as per these   Installation Instructions   3 • • Door (included)   2 Outside Air Kit (included)   Multiple Terminations......................Page 20   Chimney Adaptor ...............................Page 20   Installation Accessories .....................Page 21   Chimney Components Lists ...............Page 22   Specifications.....................................Page 23   Clearances .........................................Page 23   Replacement Parts.............................Page 24   Product Reference Information..........Page 26   1 NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   3 Download from Www.Somanuals.com. All Manuals Search And Download.   Do not burn scrap or garbage, treated wood or   wood such as driftwood from the ocean which   has been exposed to salt or other chemicals.   Salt or chemicals can corrode the firebox and   chimney. Do not burn large amounts of paper,   cardboard,Christmastreebranchesorbuilding   constructionmaterials. Intensefiringwiththese   materials may overheat the fireplace, causing   damagetotheunit, afireorevenpossiblyignit-   ing a chimney fire if the chimney is creosoted.   Burningunapprovedfuel,resultinginexcessive   pollutantsbeingemitted,maybeprohibitedand   subjecttoafineorotherpenaltybytheauthority   having jurisdiction in your area.   OPERATING THE FIREPLACE   Fuel   Building A Fire   (starting and maintaining a fire)   Tostartafire, placeseveralcrumpledupballsof   newspaperinthefirebox. Placesmalldrypieces   ofkindlingontopofthepaper,criss-crossingthe   kindling so that there are air spaces in between.   Keep the fuel far back enough so that air can   get underneath. Open the air controls fully and   light the newspaper. Once the newspaper and   thekindlingiswellignited,closethefirescreens.   Once the kindling fire is well established, cord   woodcanbeadded(seeHowToUseTheOutside   Air Register section for proper operation of the   air controls).   USE SOLID NATURAL WOOD FUEL ONLY. The   Solana™ fireplace is designed to work best   when fueled with seasoned natural wood only.   Hardwoodsarepreferredtosoftwoodssincethe   energycontentofwoodisrelativetoitsdensity.   Hardwoods will result in a longer burning fire   andlessfrequentrefueling. Amoisturecontent   of 15% to 20% (seasoned) is recommended.   Wood that has been cut and split and let to   dry under a cover for a period of one year will   usuallymeetthatcriteria.Therequireddrying   time will vary depending on the climate. Wood   that is packed tight together will take longer to   dry. Seasoned wood is darker in color than wet   wood and will have visible cracks in the grain   on the ends. Excessively wet wood will be dif-   ficult to burn and will result in lower efficiency,   increasedcreosotinganddepositsontheglass   and in the chimney. Excessively dry wood will   burn well but will also have higher emissions   and shorter burning time.   Processedfirelogscanbeused. Refertofirelog   warnings and caution markings on the packag-   ing prior to use.   The unit will burn best with 2-3 pieces of cord   wood spaced 1/2 to 1 inch apart and allowing   air to get under the fuel. Criss-crossing or ar-   ranging the fuel so that air can get underneath,   will help the fire to get started easily. The unit   shouldbeoperatedwiththeaircontrolfullyopen   long enough to get the cord wood well ignited.   First Fires   Before using the fireplace make sure to   remove the plastic wrapping on plated door.   Remove any glue residue left by the label   using mild soap.   For the Fresh FireTM system to burn efficiently,   air must flow through the bottom of the grate   and up in between the logs. Do not let ashes   stack up to a height which will obstruct the   opening between the base of the firebox and   the bottom of the log retainer.   The first five or six fires should be small fires   of short duration (about 30 to 60 minutes).   This will help cure the refractory bricks. During   the first few fires of this appliance there may   be some odor and smoke due to the curing of   the paint, dust accumulation and burning off of   lubricantsusedinthemanufacturingprocess. It   may set off a smoke alarm located in the same   room. For this reason the room should be well   ventilated for the first few fires.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   4 Download from Www.Somanuals.com. All Manuals Search And Download.   D. Wet wood   CLOSING THE DOORS   HOWTOUSETHEOUTSIDEAIRREGISTER   (FIREPLACE)   Wetortarredwoodwillsmoulderandsmoke   instead of burning properly. Your dealer can   help you determine if you have properly   seasoned wood for burning.   Assoonasalayerofemberscoversthesurface   under the log retainer, it is possible to close   the doors with the outside air register opened.   The outside air register is located on the up-   per left part of the top louver. The outside air   register supplies oxygen to the fire and allows   control of the fire when the doors are closed.   Thefreshairmustcomefromoutsidethehouse   (the air intake must not draw air from inside the   house). This will minimize negative pressure in   the house. The more you slide the register to   the left, the more fresh air into the firebox and   the more accelerated combustion you will get   (seeFigure1). Whenstartingafire,theregister   should always be fully opened.   E. Dirty or blocked chimney   Closing the doors prematurely may result in:   Checktomakesurethechimneyisclearand   clean. If dirty call a certified chimney sweep   or use a properly sized chimney brush to   clean.   • • The firebox filling with smoke;   The flame intensity cuts down excessively.   Meaning the fireplace is not hot enough to   close the doors.   F. Chimney not long enough   The minimumchimney heightis twelve (12)   feet(3.7m)notincludingthefireplaceheight.   The chimney must extend at least three (3)   feet (915 mm) above its point of contact   with the roof and at least two (2) feet (610   mm) higher than any roof or wall within ten   (10) feet (3 m) of it. When installed with   one offset, the minimum chimney height   is fifteen (15) feet. Additional height will   increasedraftandwilldecreasethetendency   to smoke.   SMOKING –   CAUSES AND TROUBLESHOOTING   Forinformationonwhenyoushouldstartclosing   the register, see "Refueling" section.   To reduce the likelihood of smoking when   opening the door, set the outside air register to   the left before opening the door. Your fireplace   hasbeendesignedandtestedtoprovidesmoke   free operation. Occasionally, there may be a   smallamountofsmokinguponlightingthefire,   until the chimney heats up but this should not   continue. If the fireplace continues to smoke   it is probably for one of the following reasons:   REFUELING   The Solana™ fireplace will operate best if at-   tention is given to operating the unit with the   outside air register fully opened (see Figure   1) after refueling in order to bring the firebox   and the chimney system up to their optimum   operating temperature. Combustion efficiency   is relative to firebox temperature. To obtain this   temperature, the fireplace must be operated   with the primary air fully opened during 10 to   20 minutes after reloading, depending on the   heat and on the moisture content of the wood.   Onceyouhavereachedthedesiredtemperature,   the outside air register control can be set to a   medium setting. The benefit of this technique   will be cleaner glass, less creosoting, greater   efficiency and the most pleasing fire for your   enjoyment.   G. Poor chimney draft   With no fire, there should be sufficient draft   to exhaust cigarette smoke introduced under   the chimney. Chimneys installed against an   outside wall without protection may generate   back draft problems which will cause start-up   problems. To prevent this, open a nearby   window, roll up a piece of paper and light it.   Then, hold it in the upper part of the firebox   to warm up the chimney. Wait until the draft   is sufficient, then start the fire.   A. The doors are partially opened   When you open the doors, open them com-   pletely.   B. Negative pressure in the house   As the fire burns, air goes up the chimney.   This air must be replaced through leakage   into the house or through the outside air   duct. WhenoperatingtheSolana™fireplace,   open a nearby window temporarily to check   if there is adequate replacement air supply.   C. Fans operating (e.g.: range hood)   Fans such as range hoods or bath fans draw   air out of the house and may actually cause   anegativepressureinthehouse. Turnoffall   fansandopenanearbywindowtodetermine   if this is the cause of the problem.   IMPORTANT CAUTIONS   A. Donotblockthehotairventstothefireplace   asthiswillcausethefireplacetooverheat.   B. Never use gasoline, gasoline-type lantern   fuel, kerosene, charcoal lighter fluid, or   similar liquids to start or ‘freshen up’ a fire   in this fireplace. Keep all such liquids well   away from the fireplace while it is in use.   C. Do not burn coal. The sulphur in coal will   corrode the firebox and chimney.   Settheairregistertothefullopenpositionbefore   opening the doors to reduce the possibility of   smoke entering the home from the fireplace.   D. Keep combustible materials at least 48”   (1.2m)awayfromthefrontofthefireplace   opening.   Push to open   E. Never leave children unattended when   there is a fire burning in the fireplace.   F. Do not use the Solana™ as an incinerator   to burn paper, cardboard or construction   material such as pressed wood, plywood   or lumber. Use only untreated wood. Wood   protectors, metallic paper, coal, plastic,   waste, beach wood, Christmas tree, sul-   phur and/or oil will damage the fireplace.   G. Donotburndriftwoodwhichhasbeeninthe   ocean or salt water. The salt will corrode   the firebox and chimney.   Push to open   H. Do not burn wood in the area in front of   the log retainer.   I. Do not allow the wood to smoulder or burn   without flame, since this will produce   excessive creosote in the unit as well as   increased particulate emissions.   Figure 1 - Outside air Register   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   5 Download from Www.Somanuals.com. All Manuals Search And Download.   Caution: It is necessary to remove the   baffle from the top of the firebox before   cleaning the chimney.   MAINTAINING YOUR FIREPLACE   Creosote - Formation and Need for Removal   When wood is burned slowly, it produces tar   and other organic vapors, which combine   with expelled moisture to form creosote. The   creosote vapors condense in the relatively   cool chimney flue of a slow-burning fire. As   a result, creosote residue accumulates on the   flue lining. When ignited this creosote makes   an extremely hot fire.   Dealing With a Chimney Fire   DILUTION   AIR BOX   INLET   Regular chimney maintenance and inspection   canpreventchimneyfires. Ifyouhaveachimney   fire, follow these steps:   1. Close the fireplace glass doors and the air   inlet.   2. Close the chimney outside air register.   3. Alert your family of the possible danger.   4. If you require assistance, alert your fire   department.   5. If possible, use a dry chemical fire extin-   guisher, baking soda or sand to control   the fire. Do not use water as it may cause   dangerous steam explosions.   6. Watch for smouldering or fire on combus-   tibles next to the fireplace and chimney.   Check outside to ensure that sparks and   hot embers coming out of the chimney are   not igniting the roof.   7. Do not use the fireplace again until your   chimney and fireplace have been inspected   byaqualifiedchimneysweeporafiredepart-   ment inspector.   The chimney shall be inspected at least twice   a year during the heating season to determine   when a creosote buildup has occurred.   Figure 2 - Baffle Removal / Chimney Access   When creosote has accumulated it shall be   removed to reduce the risk of a chimney fire.   Door Frame Care   When the creosote accumulation is large, a   creosote fire in the chimney can damage the   chimney and overheat the surrounding wood   framing. Creosote formation in a chimney can   be minimized by making sure there is always   visible flame burning, avoid smouldering fires   and by proper refuelling techniques.   Use a glass cleaner and a soft cloth to polish   the frame. Do not use abrasives such as steel   wool or steel pads for they may scratch the   door frame finish.   Disposing Of Ashes   Remove ashes only when the fire is out and   the ashes are cold (24 to 48 hours after the   fire is out).   Chimney Maintenance   Regular chimney inspection and maintenance   combined with proper operation will help   prevent chimney fires. Keep your chimney   clean. Do not allow more than a 1/16" (1.6mm)   build-up of creosote in your chimney. The   amount of creosote will depend on variables   such as frequency of use and type of fire. We   recommend that you:   Top Baffle Removal Prior to Cleaning The   Chimney   Ashes removal must be –performed regularly   duringtheoperatingseason. Anexcessofashes   will block the airflow and risks to increase the   particle emissions. In order to burn efficiently,   do not let ashes stack up to a height which will   obstruct the opening between the base of the   firebox and the bottom rod of the log retainer.   Before starting to clean your chimney, we   recommend that you remove the top baffle to   avoid creosote dust collection at the top of the   baffle. Follow these steps to set the top baffle   out of the way:   Rotatethelogretaineronthebackrefractoryand   remove the ashes. Make sure the log retainer   is properly leaning on the back refractory, in   case it’s rotation is obstructed.   A. Initially,inspectthechimneysystemweekly.   By doing this, you will learn how often it will   be necessary to clean your chimney.   1. Remove the baffle refractory and it’s iron   angle support (figure 2);   2. Obstruct the dilution air box inlet, located in   the upper back of the firebox, with a metal   or cardboard sheet;   3. Close the chimney damper and doors;   4. Proceed with chimney sweep;   5. Open the chimney damper before opening   the doors;   B. Have your chimney cleaned by a qualified   chimney sweep. If you wish to clean it your-   self, we recommend using a stiff plastic or   non-metallicbrush. Ifametalbrushisused,   its size should be slightly smaller than the   flue to avoid damaging the chimney. Do not   use a brush that will scratch the stainless   steel interior of the chimney.   C. Donotexpectchemicalcleanerstokeepyour   chimneyclean. Theraincapcanberemoved   forinspectionand/orcleaningofthechimney.   Unscrewthebraceswhichattachtheraincap   to the chimney. Using gloves, firmly grip the   upper portion of the rain cap. Turn the cap   and lift it off the chimney.   Do not leave the ashes in the house as they give   off carbon monoxide and other toxic gases.   WARNING   DisposalofAshes: Ashesshould   be placed in a metal container   withatightfittinglid. Theclosed   container of ashes should be   placed on a non-combustible   floor or on the ground well away   from all combustible materials,   pending final disposal. If the   ashes are disposed of by burial   in soil or otherwise locally dis-   persed, they should be retained   in the closed container until all   cinders have thoroughly cooled.   6. Clean out the firebox;   7. REMOVE the metal or cardboard sheet,   placed in step #2, and re-install the baffle   and it’s iron angle support.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   6 Download from Www.Somanuals.com. All Manuals Search And Download.   REFRACTORY REPLACEMENT   The intense heat of the fire will normally cause   hairline cracks in the refractory. These cracks   canbeminimizedbypropercuringasdescribed   in “First Fires”. They will not normally dimin-   ish the effectiveness of the refractory. If large   cracks develop, then the refractory should be   replaced. Toreplacetherefractorybricks,follow   these steps (see Figure 4):   1. Front Refractory   2. Bottom Refractory   3. Left Side Refractory   4. Right Side Refractory   5. Back Refractory   6. Iron Angle Support   7. Baffle Refractory   5 1. Remove the baffle refractory and it’s iron angle   support;   2. Remove the front refractory;   3. Remove the bottom refractory;   4. Remove the sides refractories * ;   5. Remove the back refractory.   4 7 6 *Holdthebackrefractorywhenthelastsiderefrac-   tory is removed, to prevent the back refractory to   fall in the firebox.   DOORS ADJUSTMENT   Glass doors may lose their adjustment during   transportation or installation of the fireplace.   A wrong adjustment may cause a loss in   combustion’s efficiency and control. The glass   doors must be parallel, at the same height and   must almost touch each other when closed.   Maximum spacing between the door's glass   is one sixteenth of an inch (1/16’’).   3 2 1 Figure 4 - Refractories Exploded View, Including Smoke Deflector   The glass doors can be adjusted by loosening   the three (3) screws of the hinges’ supports   (see fastening screws in Figure 5). If a minor   angular adjustment is needed, you may loosen   only two (2) of the three (3) screws using the   other as a pivot point.   WARNINGS   • UseonlyaLennoxHearthProductsglassdoors,specificallydesigned   for the Solana fireplace.   • The fireplace cannot be operated without doors or firescreens.   Consult your dealer to select the correct replacement door(s) or   firescreen(s).   • Important! To assure proper alignment of glass doors: Install this   fireplace in a square and plumb condition, using shims as neces-   sary at sides and/or bottom.   HOW TO USE THE RETRACTABLE DOORS   AND FIRESCREENS   TheSolana™fireplacefeaturesretractabledoors   and firescreens in order to allow a wider view   of the fire and save space when the doors are   opened. Toretractthedoors,simplyopenthem   at 90° and push them into the opening on the   sideofthefirebox. Thesameprocedureapplies   for the retractable firescreens. (see Figure 3).   Interior frame   Note: Do not operate the fireplace with both   fire-screenanddoorsclosedatthesametime.   Door to fireplace   fastening screws   Interior frame fastening   screws (10x)   Figure 5   Figure 3 - Sliding Doors / Firescreens   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   7 Download from Www.Somanuals.com. All Manuals Search And Download.   If possible, you should choose a location   where the chimney will pass through the   house without cutting floor or roof joists   (see fireplace dimensions Page 10).   GLASS CARE   Gasket Replacement   Glass Replacement   Remove the doors from the unit (see Page 6)   andlayeachdooronacleanunabrasivesurface.   To replace the gasket, first remove all of the old   gasket and gasket cement. Make sure that the   surface is totally clean before applying new   cement (a high temperature silicone caulking   ratedat500°F[260°C]issuitable)oradhesion   problems may result. Apply gasket cement to   the gasket channel and install the new gasket.   This replacement part is available from your   Lennox Hearth Products dealer in the following   dimensions:   The glass used for the Solana™ fireplace is a   hightemperatureceramicglass(1,400°F/760°   C). If the glass breaks, it must be replaced with   an identical ceramic glass. Tempered glass   or ordinary glass will not withstand the high   temperatures of the Solana fireplace. Replace-   mentglassshouldbepurchasedfromaLennox   Hearth Products dealer (see “Replacement   Parts”, Pages 24 and 25). DO NOT OPERATE   THEUNITWITHCRACKEDORBROKENGLASS.   Toremovetheglass, unscrewtheframefasten-   ing screws (see figure 5), remove the interior   frame and the glass.   B. Usually,noadditionalfloorsupportisneeded   for the fireplace. The adequacy of the floor   canbecheckedbyfirstestimatingtheweight   of the fireplace system. Weights are given   in the appendix. Note the floor construc-   tion and consult your local building code to   determine if additional support is needed.   C. The Solana fireplace may be installed di-   rectly on the floor or on a raised base (for   properguidelines,referto“HearthExtension   Requirements”) and a minimum of 7 ft (2.1   m) measured from the base of the appliance   to the ceiling is required.   Gasket * Length ** Dimen-   sions   Part No.   Glass Cleaning   3/4” dia.   (19mm)   Upper   Door   Gasket   31   (787)   PR-   COGR2035   The Solana™ fireplace is designed to keep the   glass clean under normal operating condi-   tions. To clean the glass there are a number of   specially designed cleaners. Your authorized   LennoxHearthProductsdealercanrecommend   a suitable cleaner. Regular household glass   cleaners will not clean creosote. Do not use   abrasives such as steel pads, steel wool or   oven cleaner as they will scratch the glass.   Whenselectingthelocation, thechimneyoutlet   positionandthedirectionofthewindareimpor-   tant factor affecting the chimney performance.   To allow a maximum draft and to reduce wind   turbulence, the chimney must:   3/4” dia.   (19mm)   Lower   Door   Gasket   16   (406)   PR-   COGR2035A   • Penetrate the highest part of the roof.   • Beinstalledasfaraspossibleofroofoffsets,   trees or any other obstructions that may   cause wind turbulence and back drafts in   the chimney.   • The least amount of offsets (elbows) pos-   sible.   * Note: Requires one each for one door   **Note: Inches (millimeters)   Table 1   DO NOT USE CHEMICAL GLASS CLEANERS   ON PAINTED SURFACES AS IT MAY CAUSE   THE PAINT TO PEEL.   FIREPLACE INSTALLATION   Locating The Solana Fireplace   A. The best location to install your fireplace is   determined by considering the location of   windows, doors, and the traffic flow in the   room where the fireplace is located, allow-   ing space in front of the unit for the hearth   extension and the mantel, and taking into   consideration the location of the outside air   kit and chimney.   CAUTION:DONOTALLOWWINDOWCLEANER   TO GET IN CONTACT WITH DOOR GASKET OR   PAINT ON FACADE OR DOOR. ONCE CLOSED,   CONTACT OF GLASS CLEANER WITH THE   FIREPLACE FACADE CAN PROVOKE PAINT   PEELING OFF.   Location Recommended   Marginal Location   Wind Direction   Location   Not   Recommended   Location   Not   Recommended   Outside Air Intake   Facing the Wind   Figure 6   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   8 Download from Www.Somanuals.com. All Manuals Search And Download.   Preinstallation   Please Read Before Installing:   Tools And Building Supplies Normally   Required   ADJACENT WALL   A wall perpendicular to and in front of the fire-   placefrontfacingmustbeatleast18"(460mm)   from the fireplace opening. A wall at 45º to the   front facing and starting at the fireplace’s outer   edge is permitted. Projections within this area   are permitted. See Figure 7.   Tools:   1. Before beginning the installation of your   fireplace, read these safety tips and instal-   lation instructions carefully to be sure you   understand them completely. Failure to   followthemcouldcauseafireplacemalfunc-   tion resulting in serious bodily injury and/or   property damage.   2. The Solana™ fireplace has been tested and   listed to UL and ULC standards by Warnock   Hersey International Inc. These instructions   were written to give you an outline for a fast   and safe installation and reliable operation.   Failure to use Lennox Hearth Products parts   or conduct variations in techniques and   construction materials described in this   installation manual may create a serious fire   hazard and may void the warranty and the   WHI listing.   3. Always check your local building codes.   The installation must comply with their   regulations. Before beginning the instal-   lation, consult the local authorities and   make sure your building permit complies   with their requirements.   4. ThisfireplacemustbeinstalledwithSecurity   Chimneys™chimneysystemmodelsASHT+,   S-2100+ or AC, of 8" inside diameter. The   chimney system must always vent to the   outside of the building.   5. To maintain top efficiency and to prevent   build-up of soot and creosote, inspect and   clean the chimney periodically during the   heating season.   6. To prevent possible hazards due to poor   combustion and to avoid affecting other fuel   burning appliances (furnace, wood stove,   etc.),ensurethattheoutsideairkitisproperly   installed.   7. This fireplace is designed to allow the instal-   lation of a gas burner. In such a case, the   installation must conform with the National   Gas Code ANSI Z223.1 and Z21.60.   Phillips screwdriver   Slot style screwdriver   Hammer   Saw and/or Sabersaw   Level   Measuring tape   Plumb line   Electric drill and bits   Pliers   Spacer   Wall   Square   Fireplace   If gas pipe is used:   Pipe wrench   Opening   Pipe cutter   Pipe threader   Pipe joint compound   Pipe key valve   45°   18"   (460mm)   Building supplies:   2" x 3" or heavier lumber   Figure 7   Drywall panel or equivalent   Silicone caulking (non-combustible)   Overlay material for fireplace façade   Hearth extension (non-combustible)   ENCLOSURE   1. WARNING: Do not place loose insulation or   any other material in the space around the   fireplace or the chimney. Insulation placed   on or around the fireplace or chimney may   cause adjacent wood to overheat and catch   on fire.   2. The fireplace must be installed against a   finished wall (like drywall finish). It must   not be installed against a vapor barrier or   exposed insulation (see Figure 10).   3. The fireplace is zero clearance. Combustible   materials like wood, plywood, particle board   or drywall can be in direct contact with the   fireplace reinforcements. Two inch (50 mm)   clearance to combustibles must be kept   around the chimney.   4. WARNING: The top of the fireplace is not   zero clearance. Do not place any insulating   materialinthespaceabovethefireplacefora   heightof7feetfromthebaseofthefireplace.   5. Do not block the fireplace’s hot air vents or   air inlets as this will cause the fireplace to   overheat.   PRECAUTIONS!   The most important areas of concern dealing   with the fireplace installation are clearances   to combustible materials, secure assembly of   components parts, the height of the chimney   system, the proper use of accessory equip-   ment and the techniques used in using finish-   ing materials applied to fireplace surrounds,   hearth extensions and wall coverings. Each   of these topics will be covered in greater detail   throughout this manual. Please give special   attentiontotheseinstructionsasyouprogress   with your installation.   Fireplace Installation Procedure   WARNING   When using a gas burner, it is   mandatory to keep the chimney   outside air register opened.   1. Move the fireplace into the desired position   (follow the recommendations below for   enclosure).   2. Install the outside air assembly (or assem-   blies) - refer to Page 13.   3. Installtheenclosuresurroundingthefireplace   (see Pages 9 through 12).   4. Install the hearth extension (see Page 10).   Make sure the gap between the fireplace and   the hearth extension is sealed.   8. This fireplace has provision for the installa-   tion of a gas pipe and is intended only for   connection to a decorative gas appliance   incorporating an automatic shutoff device   and complying with ANSI Z21.60-M96/CGA   2.26-M96, Standard for Decorative Gas Ap-   pliancesforInstallationinSolid-FuelBurning   Fireplaces (reference Clause 4.1.3 T).   9. The Solana™ fireplaces are sold with factory   installeddoors. Theoutsidecombustionair   kit is mandatory and is included with the   fireplace. Optional blowers and decorative   trims are available.   CHASE ENCLOSURE   Achaseisaverticalbox-likestructureconstruct-   edtosurroundthefireplaceandchimney. Refer   to Figure 10 for a typical chase configuration.   A chase should be constructed and insulated   just like any outside wall. In a cold climate,   we recommend the base of the chase should   also be insulated between the solid continuous   basebeneaththefireplaceandtheoutsidebase.   Chase insulation in a cold climate installation   is not required for safety.   LOCATING THE FIREPLACE   Do not place the fireplace on carpeting, vinyl or   othersoftsurfacefloorcoverings. Itmay, how-   ever, be directly placed on flat wood, plywood,   particle board or other hard surface materials.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   9 Download from Www.Somanuals.com. All Manuals Search And Download.   Mantel   A wood mantel, if installed, must be at least   48" (1.2 m) above the base of the fireplace (see   Figure 8B). There is no restriction regarding   the length or the width of the mantel.   WARNING: THE HEARTH EXTEN-   SION IS TO BE INSTALLED ONLY   AS ILLUSTRATED.   Fireplace   The crack between the fireplace   and the hearth extension must be   sealed with a non-combustible   material such as sand-cement   grout.   Safety Metal Strip   Hearth Extension Requirements   (refer to Figures 8A and 8B)   A non-combustible hearth extension must be   built in front of the fireplace and extend out on   both sides. Hearth extensions must be con-   structed according to the following guidelines:   Hearth Extension   Non-Combustible   Finish Material   1/2”   1. A layer of sheet metal 0.018" (0.45mm) thick   or 3/8" (9mm) thick insulating board or any   other material (tiles, marble, granite) with   equivalent heat resistance may be used.   Check with the local building authorities   before installing to determine what other   materials are acceptable in your area.   2. The hearth extension should be secured to   the floor. The gap between the fireplace and   the hearth extension must be sealed. The   suppliedsafetymetalstripmustbepositioned   as follows: One half under the front of the   fireplace and the other half must extend on   theflooroverwhichthehearthextensionwill   be built (see Figure 8A).   13mm   Floor   Fireplace   Elevated Fireplaces   uElevated fireplace installations   require a special “Z” Metal   Safety Strips (field provided),   inplaceofthesafetymetalstrip   shown above. The safety strip   should extend the full width of   the fireplace. When more than   onesafetystripisusedtheymust   overlap by a minimum of 1”.   Platform   2”   * The safety metal strip must cover the entire   width of the fireplace.   3. Onaraisedbaseorraisedhearth,a“Z”shape   piece of metal must be fabricated to join the   bottom of the fireplace to the floor (see note   1 in Figure 8A).   Figure 8A - Hearth Extension Requirements   u Hearth extension of an elevated fireplace   must respect the same minimal dimensions   as a fireplace installed directly on the floor   (figure 8B).   12" MAX.   (305mm)   Mantel   Cold Climate Installations   Climates where temperatures will fall below   32° F (0° C).   The heating performance of the appliance will   vary depending upon the level of insulation,   housedesign,howtheapplianceisoperated,etc.   If this fireplace is being installed in a cold   climate, it is especially important to seal all   cracks around the fireplace and wherever cold   air could enter the room with noncombustible   material. Also, theoutsideairinletductshould   bewrappedwithnoncombustibleinsulationto   minimize the formation of condensation. Do   not place insulation materials directly against   thechimneysections. Werecommendthatyou   use the insulated wall radiation shield since it   will maintain the home’s thermal barrier. AC   chimney is NOT recommended in very cold   climates (in areas with temperatures often get   below 0°F (-18°C).   48"   (1219mm)   Min.   6"   (152mm)   Hearth   Extension   1"   (25mm)   52"   (1320mm)   Non-Combustible   Material   18"   (457mm)   Figure 8B   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   10   Download from Www.Somanuals.com. All Manuals Search And Download.   Combustible materials can NOT be   used in the space directly above   the fireplace. Do not fill the space   above the fireplace with any mate-   rial (except the wood framing)   Corner Installation   23-11/32”   (593mm)   J D Notes   Due to Lennox Hearth Products ongoing   commitmenttoquality,allspecifications,   ratings and dimensions are subject to   change without notice.   F 2" X 3"   MIN.   All framing dimensions calculated for   1/2" dry wall at the fireplace face. If   sheathing the chase or finishing with   other thickness materials, calculations   will need to be made.   21-1/2”   (546mm)   *Thefireplacemustnotbeincontactwith   any insulation or loose filling material.   CovertheinsulationwithDrywallpanels   around the fireplace.   E 1/2” Plywood   Back Wall of Chase/Enclosure   Including Finising Materials if any   OUTSIDE CHASE   G 7' MIN.   C L * B A G H FRAMING DIMENSIONS   Fireplace Opening Width   A B C D E F G H J 43-1/4"   43-1/4"   33"   1099 mm   1099 mm   838 mm   419 mm   2159 mm   1080 mm   686 mm   660 mm   1527 mm   203 mm   25 mm   Rough Framing Face   (unfinished shown)   Rough Framing Face (Unfinished Shown)   * Zero Clearance From Back Spacer to Wall   16-1/2"   85"   Combustion Air Kit   (supplied with the   42-1/2"   27"   fireplace, mandatory)   33”   (838mm)   26"   60-1/8"   8"   10-5/8”   (270 mm)   K L 1"   27-1/2”   (699 mm)   K 43”   (1092 mm)   42-1/2”   (1080 mm)   Knock-Out   Knock-Out   for Ducting   for Ducting   42”   (1067 mm)   43”   (1092 mm)   17-1/8”   (435 mm)   Outside Air   Intake   28-5/16”   (719 mm)   Figure 9 - Framing Dimensions   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   11   Download from Www.Somanuals.com. All Manuals Search And Download.   Insulated Chase Construction   Flashing   Roof support   Non-combustible   chase top   Ceiling / floor   separation   Attic firestop   NOTE: It is recommend-   ed that the chase walls   and floor be insulated in   the same manner, using   the same insulation, as   the rest of the building,   below the attic.   • Must have the same fires rating as   adjacent ceiling.   • Must be insulated same as adjacent   ceiling.   • Local code regulation for ceiling   must be applied to the ceiling / floor   separation i.e. firestop, etc.   7’   (2.1 m)   Min.   7’ 4"   (2.2 m)   Min.   Finished wall   SEE NOTE   8’   (2.4 m)   Level   Solid   Continuous   Surface   Outside   Base   Base if required.   1/2” Plywood   Insulation   (Thermal Barrier)   Figure 10   Nailing Flanges   Fireplace Facing   Drywall panel or Equivalent   Four nailing flanges are provided to secure   the fireplace to the floor (see figure below).   Bend the nailing flanges down so that each   flange is flush with the floor, then using nails   or screws, secure the fireplace to the floor (2   places each side). The heads of the screws   or nails must be large enough to completely   cover the holes in the nailing flanges.   The fireplace should be framed using 2" x 3"   (50mm x 75mm) or heavier lumber.   2" x 3" (50mm x 75mm) Minimum   Spacer   Figure 9 on Page 11 shows the general   framing layout.   Combustiblematerialsmustbeinstalledflush   withthefireplacefacing. Theymaynotproject   out in front of the fireplace. Non-combustible   materials such as brick, stone or ceramic tile,   may project in front of and/or on the fireplace   facing.   Fireplace Side   Fireplace   Unbend to floor   and nail/screw   Nailing Flange   (2 places each side)   Figure 11 - Facing (Side View)   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   12   Download from Www.Somanuals.com. All Manuals Search And Download.   Outside Air Assembly   (Fireplace and AC Chimney)   The outside air assembly is mandatory for   the fireplace and the AC chimney.   During operation, the fireplace requires air for   combustion and draws air out of the house. It   may starve other fuel burning appliances such   asgasoroilfurnaces. Aswell, exhaustblowers   and blowerdriven appliances may compete for   air, causing a negative pressure in the home,   resulting in smoke entering the home from   the fireplace. This situation is aggravated in   modern airtight houses.   10' Maximum   To overcome this potential problem, the instal-   lationofanoutsideairassemblyisrequiredto   provide outside combustion air to the fireplace.   Loop is Mandatory   Outside Air Installation   (Fireplace and AC Chimney)   (Detail A)   The outside air assembly must be installed ac-   cording to the following guidelines:   OUTSIDE AIR CONNECTION TO THE FIREPLACE   OUTSIDE AIR CONNECTION   1. The maximum length of 4" I.D. (100 mm)   insulated flexible duct is 20 feet (6.1 m). If a   longerductisrequired,usea6"I.D.(150mm)   insulated flexible duct. The maximum length   is 40 feet (12 m). Refer to Figures 12B and   12C for connections.   2. The duct and register may be installed above   or below floor level.   3. The outside air register must not be installed   more than 10 feet (3.1 m) above the base of   the fireplace.   Fireplace   Fireplace   Connection   Outside   Intake   Aluminum Tape   Aluminum Tape   Plastic   Cover   Screw   Opening   Facing Down   Wall   Insulation   Flexible Pipe   Flexible Pipe   Plastic Cover   (Detail C)   (Detail B)   4. The outside air assembly must draw air from   outside the house. It must not draw air from   theattic,thebasementoragarage(seeFigure   6 on Page 7).   5. Locate the outside register where it will be   well away from automobile exhaust fumes   or other vents.   6. The outside air register should be installed   where it is not likely to be blocked by snow   or exposed to extreme wind.   7. It is recommended to install the outside air   register at floor level. However, if you must   raisetheairregisterabovethefireplacelevel,   you will have to make a loop to the floor with   the flexible pipe to prevent from causing a   draft in the outside air register (see Figure   12 Detail A).   Insulated Flex Pipe   (Detail D)   Figure 12 - External Air Intake   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   13   Download from Www.Somanuals.com. All Manuals Search And Download.   INSTALLATION OF THE BLOWER KIT MODEL UZY5   CENTRAL FORCED AIR KIT   If this kit is installed, this appliance no longer qualifies for EPA Low   Mass Wood-burning Fireplace Program.   NOTE: This blower kit can easily be installed when the fireplace has a   pre-installed junction box. You just have to plug them in.   The knock-outs provided on the sides of the Solana™ fireplace allow the   connection of insulated flexible pipe which enables you to heat adjacent   rooms up to 50 feet from the fireplace.   Rating: 120 Volts, 60Hz, .63A.   The blowers have magnetic blower mounts. The junction box (factory   installed on approved fireplaces for the use of this blower kit) must be   connectedto120VACservicebeforepermanentlyenclosingthefireplace.   The access hole for connecting the 120 VAC is located on the lower right   exterior side of the fireplace.   The ducting system must be installed as described below:   1. Fixtheadaptoratthesideofthefireplacebytwist-lockingtheadaptor   to the fireplace. You can use more than one outlet on the fireplace   (Figure 14).   Installation instructions:   2. Attachthe5"flexiblepipe, usingthecollarsprovided. Important:Make   sure that the plastic wrapping around the flexible pipe will not be in   contact with the fireplace.   3. Route the flexible pipe to the chosen location. The ducting system can   be installed either in an upper room or in a lower room.   1. Open the bottom louver of the fireplace.   2. Place each blower kit into the fireplace side opening 1" from the   back of the fireplace.   3. Install the automatic blower activator on the side of the firebox (the   blower activator has a magnetic mount).   4. Plug the blower kit into the junction box.   5. Ground both blowers to the back panel using the green screws (see   Figure 13).   4. Attach the flexible pipe to the blower, using the collars (Figure 15).   5. Fix the decorative grill blower adaptor to the blower.   6. Attach a standard 3" x 10" grill to the adaptor.   7. Install the blower thermostat in that part of the house to be heated by   thehotairduct. Donotinstalltheblowerthermostatintheroomwhere   the fireplace is located. A cooling thermostat can be installed in the   same room as the unit. This thermostat will turn on the blower when   the room where the fireplace is located becomes too hot.   NOTE: The fireplace must be electrically connected and grounded in   accordance with local codes or in the absence of local codes, with the   current CSA C22.1 Canadian Electrical Code. For U.S.A. installations,   follow local codes and the National Electrical Code ANSI/NFPA No 70.   This option requires electricity. Make sure that the connections to the   blower have been made according to the local codes and comply with   their requirements.   CAUTION: SHOULD THIS BLOWER REQUIRE SERVICING, THE POWER   SUPPLY MUST BE DISCONNECTED.   Theseblowersrequireperiodicmaintenance. Checktheareainfrontofthe   blowersandwipeorvacuumatleastonceamonthduringtheburnseason.   Adaptor   Thermodisc, Automatic   Thermal Blower Activator   Insulated Flex Pipe   Fan With   Magnet   Fan With   Magnet   Connector for   Optional Rheostat   Electrical Connection   With Ground Connection   Figure 13   Figure 14 - Central Forced Air Kit   Insulation   Blower   Flex 5" Diameter   Aluminum Tape   Collar   Figure 15   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   14   Download from Www.Somanuals.com. All Manuals Search And Download.   CHIMNEY SYSTEM   GENERAL INFORMATION   The Solana™ fireplace is listed only with Security Chimneys™ Interna-   tional Ltd. chimney systems, models ASHT+ 8", S-2100+ 8", or AC 8".   Do not connect the fireplace to a masonry chimney, chimney liner, or   other brand of factory-built chimney.   two (2) feet Min.   ten (10) feet   three (3) feet Min.   The Oliver Macleod chimney models HT6103 and HT6000 are respec-   tively equivalent to Security Chimneys International ltd. Chimney   models ASHT and S2100.   In areas with continuous temperatures below 0º F (-18º C), the use of   an exterior chimney increases the likelihood of operating problems such   as low draft, high rate of creosoting and poor start up characteristics.   Exterior chimneys are also prone to down-drafting and flow reversal.   Installationslocatedinabasement,incombinationwithoutsidechimneys,   are especially prone to flow reversal. In cold areas, air cooled chimneys   should not be used in an exterior installation.   Figure 17   Minimum System Heights   Caution: AC chimney should not be used in very cold areas, where   temperatures are likely to fall below 0° F (-18° C), or altitudes above   4000 feet.   Fireplace Model   Solana™   Chimney Model   ASHT+ / S-2100+ / AC   12 feet (3.66 m)   15 feet (4.57 m)   17 feet (5.18 m)   Vertical Installation   One Offset (2 elbows)   Two Offsets (4 elbows)   Table 2   A chimney venting a fireplace shall not vent any other appliance.   The minimum system heights are indicated in Table 2.   In altitude, add 18" (450mm) to the chimney for every 2000 feet (600   m) above sea level.   Note:2"clearancetocombustiblesaroundchimneycomponentsrequired.   Allchimneyinstallationsmustincludeatleastonesupport. Themaximum   length of chimney that can be supported by the fireplace is 12 feet (3.6 m)   for S-2100+, 18 feet (5.4 m) for ASHT+ and 26 feet (8 m) for AC chimney.   Note:Blownorfilltypeinsulationmaterialsmustnotbeincontactwiththe   fireplace or in the enclosure frame as described in ‘’Enclosure’’ section.   Note: Local codes may not require firestopping at the ceiling levels for   outside chase installations. However, it is recommended for safety and   the reduction of heat loss.   The chimney must extend at least 3 feet (915mm) above its point of   contact with the roof and at least 2 feet (610mm) higher than any wall,   roof or building within 10 feet (3 m) of it (see Figure 18).   If the chimney extends higher than 5 feet (1500mm) above its point   of contact with the roof, it must be secured using a roof brace or   guide wires.   Chimney Height   The total height of your completed fireplace system from the surface the   fireplacerestsontothechimneytopmustnotexceed60'. Chimneyheight   must also meet minimum height requirements, excluding the fireplace   height, indicated in Table 2. Refer to the minimum system height chart.   A rain cap must be installed on top of the chimney. Failure to install a   rain cap may cause the fireplace to corrode and operate inefficiently.   Cutandframesquareholesinallfloorsandtherooftoprovidea2"(50mm)   clearance between the chimney and any combustible materials. Do not   fill this 2" (50mm) space with any material (see Figure 19).   In altitude, add 18" (450 mm) to the chimney for every 2000 feet (600   m) above sea level.   Portions of the chimney which may extend through accessible spaces   must be enclosed to avoid contact with combustible materials or dam-   age the chimney.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   15   Download from Www.Somanuals.com. All Manuals Search And Download.   CHIMNEYINSTALLATIONINSTRUCTIONS   1. Cut and frame the holes in the ceiling,   floor and roof where the chimney will pass   (see Figure 19). Use a plumb-bob to line   up the center of the holes. The hole sizes   are indicated in Table 3 for the floor and   ceiling holes and in Table 4 (Page 17) for   the roof holes.   Attic Radiant   Firestop   AC RSA   AC RS   CHIMNEY MODEL   8"   SQUARE HOLE   SIZE OPENING   AC   Firestop   ASHT+ and S2100+   Air Cooled Pipe   ASHT+ / HT6103+   S-2100+ / HT6000+   AC   14-3/8” (365 mm)   16” (406 mm)   15" (380 mm)   Figure 20A   Figure 20B   Note: See Table 4 for Sloped Roof Framing   Table 3 - Flat Roof Framing   AC CHIMNEY INSTALLATION   (AIR COOLED INSULATED GALVALUME CHIMNEY)   Flashing   Support   Rain Cap   Flashing Collar   Figure 19   Attic Radiation   Shield   2. Frombelow,installafirestopineachceiling/   floorseparationthroughwhichthechimney   will pass. At the attic level, install an attic   radiation shield from above (see Figures   20A and 20B).   Radiation   Shield   3. For ASHT+ and S-2100+ chimneys, place   thefirstchimneylengthonthefireplace. To   lock it into place, turn 1/4 of a turn clock-   wise. With the AC chimney you must use   a starting section before installing the first   chimney length (see Figure 21). Continue   installing chimney lengths making sure to   lock each length in place.   AC Air Cooled   Chimney Starting Piece   4. Every time the chimney passes through a   rooforawall,installtheappropriatefirestop.   When you reach the desired height, install   the roof support (see instructions included   with the support).   5. Then, put the roof flashing in place and seal   the joint between the roof and the flashing   with roofing pitch. For sloping roofs, place   theflashingundertheuppershinglesandon   top of the lower shingles. Nail the flashing   to the roof, using roofing nails (Figures 22   and 23).   Cooling Air Kit For Air   Cooled Chimney ACZI   (required when   using AC chimney)   Note: The outside air kit is mandatory   for both fireplace and chimney   Outside Combustion   Air Kit (UZI)   6. Place the storm collar over the flashing and   tightenitwiththeboltsupplied. Finally,seal   the joint between the storm collar and the   chimney, using silicone caulking.   Figure 21   7. Install the chimney cap. Once the chimney   cap is in place, the roof flashing can be   washed with a solvent or vinegar and then   painted with rust-proof paint.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   16   Download from Www.Somanuals.com. All Manuals Search And Download.   Afterreachingthelocationrequiringtheelbow,   proceed as follows:   AC   Air Cooled Chimney   Chimney   ASHT+/HT6103+/S2100+/HT6000+Chim-   neys   Collar   Spacer (built   into flashing)   1. Install the first elbow. Turn it in   the required direction. Fasten it to   the chimney with the three (3) 1/2"   (12mm) metal screws provided.   2. Install the necessary lengths to achieve   the required offset. Lock the chimney   lengths together: it is recommended to   use three (3) 1/2" (12mm) screws. If the   offset length is made of two (2) chimney   lengths use an offset support halfway up   the offset. If penetrating a wall, install a   wall radiation shield (see Figure 27).   3. Use another elbow to turn the chimney   vertically. Secure the elbow, using three   (3) 1/2" (12mm) screws (provided with   the elbow).   Flashing   Figure 23   Figure 22   Roof Down Slope Hole Size   4. Use a plumb-bob to line up the center of   the hole. Cut a hole for the chimney in the   ceiling/floor. Frame this hole as described   previously (see Chimney Installation   Instructions on Page 16).   5. From below, install a radiation shield   (Figure 20A).   6. A support (ST+ or SO+) must be used on   the first 15 feet section (5 m).   7. Continue with the regular installation.   SLOPE   ASHT+   8"   S-2100+   8"   AC   8"   Roof   Pitch   0 *   2/12   4/12   6/12   8/12   10/12   12/12   14-3/8" (365mm)   14-5/8" (371mm)   15-1/4" (387mm)   16-1/8" (410mm)   17-3/8" (441mm)   18-3/4" (476mm)   20-3/8" (518mm)   16" (406mm)   15" (380mm)   16-1/4" (413mm)   16-7/8" (429mm)   17-7/8" (454mm)   19-1/4" (489mm)   20-7/8" (530mm)   22-5/8" (575mm)   15-3/8" (390mm)   16-1/8" (410mm)   16-7/8" (430mm)   18-1/4" (465mm)   19-5/8" (500mm)   21-3/8" (545mm)   AC chimney   1. Installthefirstelbow.Turnitintherequired   direction. To lock it in place, turn 1/8 of   a turn. Fasten the straps attached to the   elbow to the surrounding framing using   nails or drywall screws (Figure 25).   2. Install the necessary chimney lengths   to achieve the required offset. Lock the   chimney lengths together. If penetrating   a wall, use a wall radiation shield (Figure   27).   3. Use another elbow to turn the chimney   vertically. Lock it to the chimney. Fasten   the straps attached to the elbow to the   surroundingframingusingnailsordrywall   screws.   * Cross slope hole size   Put the chimney cap into place.   Wash the roof flashing with a solvent or vinegar, then paint it with rust-proof paint.   Table 4   OFFSET CHIMNEY INSTALLATION   After reaching the location requiring the elbow, proceed as follows. The minimum chimney height   excluding the fireplace height is shown in Table 2.   Notes:   • Must return to vertical before penetrating ceiling or floor.   • A maximum of 2 offsets are allowed.   4. Use a plumb-bob to line up the center of   the hole. Cut a hole for the chimney in   the ceiling. Frame this hole as described   previously.   5. From below, install a radiation shield (see   Figure 20B).   6. Continue with the regular installation.   Note: When using AC chimney, an AC8SB   (H3801) starter section must be used before   installinganelbow. Whenanoffsetisneeded   immediately off the top of the fireplace, an   elbow starter section, AC8SB30 (H3802) is   available.   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   17   Download from Www.Somanuals.com. All Manuals Search And Download.   Offset Dimensions   B Total Height   A Horizontal Offset   Chimney Elbow   8”   Offset &   Height   One Length Between Elbows   Two Lengths Between Elbows   8” & 48” 12” & 48” 18” & 48” 24”&48” 36” & 48” 48” & 48”   8”   12”   18”   24”   36”   10-1/2"   48"   3-5/16"   (84mm)   4-5/16"   5-7/8"   7-7/16"   13-5/8"   (346mm)   15-3/8"   16-7/16"   (418mm)   18"   (457mm)   19-1/2"   (495mm)   22-5/8"   (575mm)   25-3/4"   (654mm)   15º   A (110mm) (149mm) (189mm) (267mm)   (391mm)   15-11/16"   (398mm)   19-9/16" 25-3/8" 31-3/16" 42-3/4"   (497mm) (645mm) (792mm) (1086mm) (1381mm) (1548mm) (1646mm) (1792mm) (1940mm) (2210mm) (2529mm)   54-3/8"   60-15/16" 64-13/16"   70-9/16"   76-3/8"   87"   99-9/16"   B A Secure   Temp   ASHT +   7-7/16"   (189mm)   9-7/16"   12-7/16"   15-7/16"   21-7/16"   27-7/16"   (697mm)   30-13/16" 32-13/16"   35-13/16" 38-13/16"   (910mm)   44-13/16"   50-13/16"   30º   (240mm) (316mm) (392mm) (545mm)   (783mm)   (833mm)   (986mm) (1138mm) (1291mm)   20"   (508mm)   23-1/2" 28-11/16" 33-7/8" 44-1/4"   (597mm) (729mm) (860mm) (1124mm) (1389mm) (1538mm) (1627mm) (1759mm) (1891mm) (2154mm) (2419mm)   54-11/16"   60-9/16"   64 "   69-1/4"   74-7/16" 84-13/16" 95-1/4"   Nova   Temp   B A HT6103+   45º   10-5/16"   (262mm)   13-3/16"   17-3/8"   21-5/8"   30-1/8"   38-5/8"   (981mm)   43-7/16"   46-1/4"   50-1/2"   54-3/4"   63-1/4"   71-11/16"   (335mm) (441mm) (549mm) (765mm)   (113mm) (1175mm) (1283mm) (1391mm) (1607mm) (1818mm)   17-13/16"   (452mm)   20-5/8" 24-7/8" 29-1/8" 37-5/8"   (524mm) (632mm) (740mm) (956mm) (1172mm) (1294mm) (1365mm) (1473mm) (1581mm) (1797mm) (2011mm)   46-1/8"   50-15/16" 53-3/4" 58" 62-1/4" 70-3/4" 79-3/16"   B Chimney   Offset &   Height   One Length Between Elbows   Two Lengths Between Elbows   Elbow   8”   8”   12”   18”   24”   36”   48”   8” & 48” 12” & 48” 18”&48” 24”&48” 36”&48”   48” &48”   3-5/16"   (84mm)   4-5/16"   (110mm)   5-7/8"   7-7/16"   10-1/2"   13-5/8"   (346mm)   15-1/2"   (394mm)   16-1/2"   (419mm)   18-1/16"   (459mm)   19-5/8"   (498mm)   22-3/4"   (578mm)   25-13/16"   (656mm)   A Secure   Temp   (149mm) (189mm) (267mm)   15º   30º   16"   (406mm)   19-7/8"   (505mm)   25-11/16" 31-1/2" 43-1/16"   (652mm) (800mm) (1094mm) (1387mm) (1561mm) (1657mm) (1805mm) (1953mm) (2248mm) (2542mm)   54-5/8"   61-7/16"   65-1/4"   71-1/16"   76-7/8"   88-1/2"   100-1/16"   B A S2100+   7-3/8"   (187mm)   9-3/8"   (238mm)   12-3/8"   15-3/8"   21-3/8"   27-3/8"   (695mm)   30-7/8"   (784mm)   32-7/8"   (835mm)   35-7/8"   (911mm)   38-7/8"   44-7/8"   50-7/8"   Nova   (314mm) (391mm) (543mm)   (987mm) (1140mm) (1292mm)   Temp   20-11/16"   (525mm)   24-3/16"   (614mm)   29-3/8" 34-9/16" 44-15/16"   (746mm) (878mm) (1141mm) (1405mm) (1559mm) (1648mm) (1780mm) (1911mm) (2175mm) (2438mm)   55-5/16"   61-3/8"   64-7/8"   70-1/16"   75-1/4" 35-5/8" 96"   HT6000+   B Chimney Elbow   8”   Offset &   Height   One Length Between Elbows   Two Lengths Between Elbows   ---   12”   18”   ---   36”   48”   ---   12” & 48” 18” & 48”   ---   36” & 48” 48” & 48”   ----   ----   4-13/16"   (122mm) (156mm)   6-1/8"   ----   ----   11"   (280mm)   14-1/8"   (359mm)   ----   ----   16-7/8"   (429mm)   18-7/16"   (468mm)   ----   ----   23"   (584mm)   26-3/16"   (665mm)   A 15º   ----   ----   27-11/16" 33-1/2"   ----   ----   50-7/8"   (1292mm) (1588mm)   62-1/2"   ----   ----   72-5/8"   (1845mm) (1992mm)   78-7/16"   ----   ----   95-3/4"   (2432mm) (2727mm)   107-3/8"   B A (703mm) (851mm)   9-3/8" 12-3/8"   AC   8”   ----   ----   ----   ----   21-3/8"   (543mm)   27-3/8"   (695mm)   ----   ----   32-5/8"   (829mm)   35-5/8"   (905mm)   ----   ----   44-5/8" 50-5/8"   (238mm) (314mm)   (1134mm) (1286mm)   86-7/8" 97-1/4"   30º   ----   ----   25-3/4" 31"   (654mm) (787mm)   ----   ----   46-1/2"   (1181mm) (1448mm)   57"   ----   ----   66"   71-1/4"   ----   ----   B (1676mm) (1810mm)   (2207mm) (2470mm)   N OTE: With the AC chimney, a starting length of 6” high must be used on top of the fireplace before installing an elbow.   Figure 24   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   18   Download from Www.Somanuals.com. All Manuals Search And Download.   ANGLED WALL RADIATION SHIELD   (RSM+, RSMI30, RSMI45)   OFFSET CHIMNEY INSTALLATION   Chimney AC   When traversing a combustible wall with the chimney at a 30° or 45°   angle, an angled firestop and/or wall radiation shield must be installed.   Only one is required (Figure 27). Table 6 gives recommended hole size   for installing a wall radiation shield.   Note: 45° angle installation for Canada only.   Brace   ACRS   (radiation   shield)   Straps   In cold climate locations (climates where temperatures will fall below   32° F / 0° C), we recommend that you use the insulated wall radiation   shield since it will maintain the home’s thermal barrier.   Straps   RSM+ and RSMI30, RSMI45   Support   Chimney Model   ASHT+ (8" I.D.)   Canada Only   S-2100+ (8" I.D.)   Canada Only   AC (8" I.D.)   Table 6   Angle   Hole Size   30º 14-3/8" x 36-1/2” (365mm x 927mm)   45º 14-3/8" x 24-3/4” (556mm x 629mm)   Note: This illustration is not to   scale. It represents how the   chimney must be supported. A   30degreeoffsetonlyisallowed   in the USA and a 45 degree   maximum offset is allowed in   Canada.   30º   45º   16" x 40” (406mm x 1016mm)   16" x 27-1/4” (406mm x 692mm)   30º 15-1/4" x 38-1/4” (365mm x 927mm)   Insulated Wall   Figure 25   OFFSET CHIMNEY INSTALLATION WITH WALL PENETRATION   Drywall   Rain Cap   Storm Collar   Roof Support   Flashing   Insulated   Wall   Angel Wall Radiation Shield   (Insulated)   Offset Support   Figure 27   Framing   2” x 4”   Angled Insulated Wall   Radiation Shield   Note: In cold areas it is recom-   mended to protect the chimney   in a insulated chase.   Figure 26   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   19   Download from Www.Somanuals.com. All Manuals Search And Download.   UNIVERSAL ROOF SUPPORT INSTALLATION   This support has three possible uses:   18” (460 mm)   16” (410 mm)   18” (460 mm)   16” (410 mm)   1. For ASHT+ and S-2100+ chimneys, it must be used on a roof to   support the chimney.   2. It may be used on a floor, ceiling or roof above an offset to support   the chimney above the offset.   3. It may be used on a floor, ceiling or roof as a supplementary support   when the chimney height exceeds 15 feet (4.6 m.).   18” (460 mm)   Table 7 gives maximum height of supported chimney.   NOTE: For the AC chimney, a support section (AC8SL) must be used   every 40’ (12 m) instead of the universal roof support (ST).   For roof support installation, refer to the instructions provided with the   support.   Figure 28   Universal Offset Support   This support is used to support the chimney above an offset. When   the chimney offset is used to traverse a wall, this support may be used   on the wall to support the chimney. The maximum heights are given in   Table 7. For offset support installation, refer to the instructions provided   with the support.   CHIMNEY ADAPTOR (S-2100+ / HT6000+) CANADA ONLY   The fireplace is normally supplied with a chimney adaptor suitable for the   ASHT / HT6103+ chimney. If you want to install a S-2100+ / HT6000+   chimney, an adaptor is available (8UCA) (Figure 29). A separate starter   section will also be required if AC chimney is installed.   MAXIMUM HEIGHT OF   SUPPORTED CHIMNEY   Chimney Model   Offset Support   Roof Support   ASHT+ 8" I.D.   S-2100+ 8" I.D.   AC 8" I.D.   20 feet (6.10 m)   14 feet (4.30 m)   40 feet (12.19 m)   24 feet (7.32 m)   16 feet (4.87 m)   50 feet (15.20 m)   Chimney Adaptor -   Canada only   Table 7   CHIMNEY CHASE AND MULTIPLE TERMINATIONS   For the purpose of this manual, a chimney chase is considered a part of   the chimney system rather than part of a building. The termination must   be placed a minimum of 18" (460mm) above the chase.   Forinstallationwheremorethanonechimneyislocatedinthesamechase   or within the same general area, we suggest that their terminations be   separated by at least 16" (410mm) horizontally and 18" (460mm) verti-   cally. This separation is to prevent smoke migrating from one chimney   to another (see Figure 28).   Figure 29 - S-2100 Chimney Adaptor   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   20   Download from Www.Somanuals.com. All Manuals Search And Download.   OPTIONAL INSTALLATION ACCESSORIES - SOLANA™   Installation Accessories   Installation Accessories   Description   Cat./ Part No.   Forced Air Heating Kit   Description   Cat./ Part No.   Starter Kit includes: blower (BISZY), flex adaptor and   two clamps (BISAF), blower variable speed control   (VRUW), Thermo-disc (VTU), blower flex adaptor   (BISAVF), and back draft damper (BISBD)   BISFWK-1   Outside Air Kit (Required - Included with Fireplace)   Outside Air Coupler to connect outside air UZI to   fireplace, UZIAD   UZIDF   Flex - Choose 15 feet or 25 feet depending on installation   Outside Air Ducting - Includes 4" insulated flex x 10 ft.   long, UZI   UZI   Flex 5 inches ID x 15 feet Long   Flex 5 inches ID x 25 feet Long   Starter Kit Separate Components   5FLEX15   5FLEX25   Fireplace Options   Horizontal Trim Kit - Brushed Nickel   Blower   H3395   UZY5   Blower flex adaptor, includes damper (BISBD)   Blower - 250 CFM   BISAVF   BISZY   BISAF   VRUW   VTU   Blower Motor Speed Control   VRUW   Flex adaptor and two clamps for fireplace connection   Blower motor speed control   Thermo-disc - turns motor on when fireplace is hot and   off when cool   Fireplace Model Solana™ - Approved Venting Components   Back draft damper   BISBD   HCTW   8" Diameter Chimney - Model ASHT+, S-2100+, HT6000+, HT6103+ or AC   Options   manufactured by Security Chimneys International only.   Heating / Cooling Thermostat - 110V   Notes:   1. (Projet NovaTemp™) HT6000+ is equivalent to S-2100+   2. (Projet NovaTemp™) HT6103+ is equivalent to ASHT+   3. This appliance is equipped with the ASHT Chimney Adaptor. When other   chimney is used, a chimney adaptor for the chimney will be required.   4. Chimney Adaptor (S-2100+ / HT6000+) for CANADA ONLY - If you want to   install a S2100+ / HT6000+ chimney, an adaptor is available (8UCA).   5. AC Chimney is Not recommended at elevations above 4000 feet or in very   cold climates where temperatures are likely to fall below 0° F (-18° C). When   using AC chimney, an AC8SB (H3801) starter section must be used before   installing an elbow. When an offset is needed immediately off the top of the   fireplace, a starter section, AC8SB30 (H3802), is available.   21   Download from Www.Somanuals.com. All Manuals Search And Download.   COMPONENTS LIST - SOLANA™   Secure Temp™ ASHT+ High Temp. Insulated Stainless Steel Chimney   AC Chimney   (Air Cooled - 8" I.D., 13" O.D.)   8" Diameter, Listed to CAN / UCL-S604 and UL-103HT at 1200° F   Description   Cat./ Part No.   Description   Cat./ Part No.   Lengths and Misc. Chimney Components   AC Starter Adaptors   An AC Adaptor is Need to Convert Fireplace for Use with AC Chimney   8" Length, 8" Dia., 8L8   8L8   8L12   8L18   8L24   8L36   8L48   8LA   Starter Section (adaptor), 8" AC, AC8SB   Starter 30º Elbow, 8" AC, AC8SB30   H3801   H3802   12" Length, 8" Dia., 8L12   18" Length, 8" Dia., 8L18   24" Length, 8" Dia., 8L24   36" Length, 8" Dia., 8L36   48" Length, 8" Dia., 8L48   Adjustable Length 12", 8" Dia., 8LA   15° Elbow, 8" Dia., 8E15   30° Elbow, 8" Dia., 8E30   Rain Termination Cap, 8" Dia., 8CC   Wall Band, BM   Outside Air Kit (Chimney)   Required for AC Chimney Installations   Chimney Outside Air Kit (flex, insulation, outside register   and coupling), ACZI   H1967   Lengths and Misc. Chimney Components   18" Length, 8" Dia. x 18" Long, AC8L18   36" Length, 8" Dia. x 36" Long, AC8L36   48" Length, 8" Dia. x 48" Long, AC8L48   15º Elbow, 8" Dia., AC8E15   8E15   8E30   8CC   H3798   H3799   H3800   H3795   H3796   H3794   PE   BM   Supports   30º Elbow, 8" Dia., AC8E30   Offset Support, SO   Roof Support, ST   Roof Brace, BS2   SO   ST   Rain Termination Cap, 8" Dia., AC8CPR   Spark Arrester Screen (universal spark arrester band)   PE+   BS2   Wall Band, XBM   XBM   Firestops   Supports   Telescopic Attic Radiation Shield, 8ARSA   Firestop, 8BF   8ARSA   8BF   Offset Support, SO   XSO   H3804   XST   Support Section, AC8SL   Roof Support, ST   Radiation Shield, 8RS   8RS   Insulated Attic Radiation Shield, 8RSA   Insulated Wall Radiation Shield, 8RSM   8RSA2   8RSM   Roof Brace, BS2   XBS2   Roof Flashings   Roof Flashings   Flat Roof Flashing, ACF   H0494   H0495   H0496   H0500   Flat Roof Flashing, 8FR   1/12 - 7/12 (5º - 30º), 8FAR   8/12 - 12/12 (30º - 45º), 8FBR   Storm Collar, 8FC   8FR   8FAR   8FBR   8FC   1/12 - 7/12 (5º - 30º), AC, Adj. Roof Flashing, FA   8/12 - 12/12 (30º - 45º), AC, Adj. Roof Flashing, FB   Storm Collar, ACFC   Misc.   Telescopic Attic Radiation Shield, ACRST   Firestop, ACBF   H0498   H0485   Radiation Shield, ACRS   H0486   Attic Radiation Shield, ACRSA   Wall Radiation Shield, 30, AC, RSM30   Insulated Wall Radiation Shield, 30, ACRSMI30   H0487   ACRSM30   H0489   Notes: AC Chimney is Not recommended at elevations above 4000 feet or   in cold climates.   22   Download from Www.Somanuals.com. All Manuals Search And Download.   CLEARANCE TO COMBUSTIBLES   Fireplace   Cat. No.   Model   Description   The following clearances meet the minimum requirements for a safe   installation;   H7703   SOLANA-BK   Solana (w/Black Doors)   H7704   SOLANA-BN   Solana (w/Brushed Nickel Doors)   Side wall: 18” (457 mm)   Ceiling: 7 feet (2135 mm) measured from the base of the fireplace   Specifications   Weight   343 lbs   42”   Fireplace enclosure:   Bottom: 0”   Height   Width   Depth   43”   Side: 0” to spacer   Back: 0” to spacer   26-5/8”   8.75 lb/ft.   13.2 lb/ft.   3.75 lb/ft.   Top:   Do not fill the space above the fireplace with any material,   7 feet measured from the base of the fireplace (Except the   wood framing). See Page 11, Figure 9.   Chimney Weight ASHT+ (8” dia)   Chimney Weight S-2100+ (8” dia.)   Chimney Weight AC (8” dia.)   Chimney: 2” (50 mm)   Mantel: 48” (1219 mm) measured from the base of the fireplace.   23   Download from Www.Somanuals.com. All Manuals Search And Download.   REPLACEMENT PARTS LIST - SOLANA™   Description   Refractory Baffle   Cat. No.   PR-SR2028   PR-SR2027   PR-SR2025D   PR-SR2025G   PR-SR1722   PR-SR2026   H7706   Item #   1 Description   Ceramic Glass Panel   Cat. No.   PR-VC10   VTU   Item #   19   2 Back Refractory   ---   Thermostatic Disc Control, Blower   3 Right Side Refractory   Left Side Refractory   Bottom Refractory   20   PR-COGR2035   Door Gasket, 31" see note below u   4 21   PR-COGR2035A   Door Gasket, 16" see note below u   Horizontal Glass Gasket (for black doors)   Vertical Glass Gasket (for black doors)   5 ---   ---   ---   PR-SR1685A   PR-SR1685B   PR-ISO2938   6 Front Refractory Ash Lip   Log Support Grate   7 Upper Glass Gasket (for nickel plated doors) v   8 Top Louver   PR-SR15P   PR-SR15P   PR-PIVOT   PR-PARETIND-1   PR-PARETING-1   H7708   ---   ---   22   PR-ISO2939   PR-ISO2750   PR-SR2798   Side Glass Gasket (for nickel plated doors) v   9 Bottom Louver   Lower Glass Gasket (for nickel plated doors) v   10   11   12   13   14   15   16   17   18   Louver Hinges   Damper (plate, pivot, rod and counter-weight)   Rigid Firescreen (Right)   Rigid Firescreen (Left)   Black Door (Left)   u Note: To order the complete gasket set to seal one door, order 1 each   P/N PR-COGR2035 (31") and 1 each P/N PR-COGR2035A (16").   Black Door (Right)   Brushed Nickel Plated Door (Left)   Brushed Nickel Plated Door (Right)   Wooden Handle   H7707   v Note: To order a complete gasket set to seal one glass on a nickel plated   door, order one each P/N PR-ISO2938 , P/N PR-ISO2939 and P/N PR-ISO2750.   H7710   H7709   Contact an Authorized Lennox Hearth Products dealer to obtain any of   these parts. Never use substitute materials not approved by Lennox   Hearth Products. Use of non-approved parts can result in poor perfor-   mance and safety hazards.   PR-SAC83   70K99   Touch-up Paint, Aerosol, Black Metallic   SBMB6309   24   Download from Www.Somanuals.com. All Manuals Search And Download.   REPLACEMENT PARTS - SOLANA™   22   1 10   8 9 7 2 3 10   6 4 5 11   18   20   12   14   I 16   21   19   13   15   17   NOTE: DIAGRAMS & ILLUSTRATIONS ARE NOT TO SCALE.   25   Download from Www.Somanuals.com. All Manuals Search And Download.   Normally, all parts should be ordered through your Lennox Hearth   Products distributor or dealer. Parts will be shipped at prevailing prices   at time of order.   WARRANTY   Your fireplace is covered by a limited warranty. Please read the warranty   to be familiar with its coverage.   When ordering repair parts, always give the following information:   Retainthismanual. Fileitwithyourotherdocumentsforfuturereference.   1. The model number of the appliance *   2. The serial number of the appliance *   3. The part number   PRODUCT REFERENCE INFORMATION   4. The description of the part   5. The quantity required   6. The installation date of the appliance   We recommend that you record the following important information   about your fireplace. Please contact your Lennox Hearth Products dealer   for any questions or concerns. For the number of your nearest Lennox   Hearth Products dealer, please call 1-800-9-LENNOX.   * See listing/certification label located behind bottom louver on the left   side of fireplace base.   REPLACEMENT PARTS   If you encounter any problems or have any questions concerning the   installation or application of this system, please contact your dealer.   See Pages 24 and 25 for a complete replacement parts list. Use only   parts supplied from the manufacturer.   LENNOX HEARTH PRODUCTS   1508 Elm Hill Pike, suite 108   Nashville, TN 37210   Your Fireplace's Model Number________________________________________   Your Fireplace's Serial Number ________________________________________   The Date On Which Your Fireplace Was Installed___________________________   Your Dealer's Name _________________________________________________   Your Dealer's Phone Number__________________________________________   Lennox Hearth Products reserves the right to make changes at any time, without notice, in   design, materials, specifications, prices and also to discontinue colors, styles and products.   Consult your local distributor for fireplace code information.   Printed in U.S.A. © 2009 by Lennox Hearth Products   1508 Elm Hill Pike, suite 108 • Nashville, TN 37210   P/N 506023-07 REV. B 06/2010   26   Download from Www.Somanuals.com. All Manuals Search And Download.   |